Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2353
Gene name Gene Name - the full gene name approved by the HGNC.	Fos proto-oncogene, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOS
Synonyms (NCBI Gene) Gene synonyms aliases	AP-1, C-FOS, p55
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have b

Show/Hide all(366)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001219	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	19133651
MIRT001219	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	19133651
MIRT004484	hsa-miR-221-3p	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	20299489
MIRT004485	hsa-miR-222-3p	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	20299489
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	19133651
MIRT001219	hsa-miR-101-3p	Review	20026422
MIRT001219	hsa-miR-101-3p	qRT-PCR	20712078
MIRT001219	hsa-miR-101-3p	Western blot	19008416
MIRT006851	hsa-miR-181a-5p	Luciferase reporter assay	22956783
MIRT006851	hsa-miR-181a-5p	Luciferase reporter assay	22956783
MIRT006976	hsa-miR-139-5p	qRT-PCR, Western blot	23001723
MIRT007254	hsa-miR-29b-3p	Western blot	23254643
MIRT004485	hsa-miR-222-3p	Luciferase reporter assay	23400877
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay	23400877
MIRT019187	hsa-miR-335-5p	Microarray	18185580
MIRT024954	hsa-miR-215-5p	Microarray	19074876
MIRT026898	hsa-miR-192-5p	Microarray	19074876
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay	23400877
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay	23400877
MIRT053066	hsa-miR-490-5p	Flow, Luciferase reporter assay, Western blot	24220339
MIRT053434	hsa-miR-155-5p	Microarray	23807165
MIRT437420	hsa-miR-181b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23810250
MIRT437420	hsa-miR-181b-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23810250
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT004485	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT004484	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT476791	hsa-miR-8080	PAR-CLIP	23592263
MIRT476790	hsa-miR-6816-3p	PAR-CLIP	23592263
MIRT476789	hsa-miR-8083	PAR-CLIP	23592263
MIRT476787	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT476788	hsa-miR-6854-3p	PAR-CLIP	23592263
MIRT476786	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT476785	hsa-miR-548v	PAR-CLIP	23592263
MIRT476784	hsa-miR-6077	PAR-CLIP	23592263
MIRT476783	hsa-miR-19a-5p	PAR-CLIP	23592263
MIRT476782	hsa-miR-19b-1-5p	PAR-CLIP	23592263
MIRT476781	hsa-miR-19b-2-5p	PAR-CLIP	23592263
MIRT476780	hsa-miR-5581-3p	PAR-CLIP	23592263
MIRT476779	hsa-miR-937-5p	PAR-CLIP	23592263
MIRT476778	hsa-miR-627-5p	PAR-CLIP	23592263
MIRT476777	hsa-miR-5089-3p	PAR-CLIP	23592263
MIRT476776	hsa-miR-8081	PAR-CLIP	23592263
MIRT476775	hsa-miR-6885-3p	PAR-CLIP	23592263
MIRT476774	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT476773	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT007254	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT476772	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT476770	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT476771	hsa-miR-3065-3p	PAR-CLIP	23592263
MIRT476769	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT476768	hsa-miR-4530	PAR-CLIP	23592263
MIRT476767	hsa-miR-338-3p	PAR-CLIP	23592263
MIRT440620	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT440619	hsa-miR-543	HITS-CLIP	24374217
MIRT440618	hsa-miR-770-5p	HITS-CLIP	24374217
MIRT440620	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT440619	hsa-miR-543	HITS-CLIP	24374217
MIRT440618	hsa-miR-770-5p	HITS-CLIP	24374217
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	27073439
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	27073439
MIRT001219	hsa-miR-101-3p	Luciferase reporter assay	27073439
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT731770	hsa-miR-7-5p	ChIP-seq, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	26261179
MIRT053434	hsa-miR-155-5p	ChIP, mRNA decay, qRT-PCR, Western blot	27513856
MIRT006976	hsa-miR-139-5p	qRT-PCR, Western blot	27668889
MIRT006976	hsa-miR-139-5p	qRT-PCR, Western blot	27668889
MIRT053066	hsa-miR-490-5p	qRT-PCR, Western blot	26170849
MIRT734571	hsa-miR-766-3p	Microarray	32645133
MIRT735529	hsa-miR-203a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32454462
MIRT006976	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, in vivo gain/loss-of-function experiments	32641995
MIRT006976	hsa-miR-139-5p	Western blotting, qRT-PCR, Flow cytometry	34249000
MIRT006976	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR	32641995
MIRT004484	hsa-miR-221-3p	Luciferase reporter assay, Western blotting, Microarray, RNA-seq, qRT-PCR, Flow cytometry	32188026
MIRT004484	hsa-miR-221-3p	qRT-PCR	32280695
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509846	hsa-miR-4438	PAR-CLIP	23446348
MIRT509847	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT509845	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509844	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509843	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509842	hsa-miR-3622b-5p	PAR-CLIP	23446348
MIRT509841	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT509840	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT509839	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT509838	hsa-miR-5095	PAR-CLIP	23446348
MIRT509837	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509836	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT004485	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT004484	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT476791	hsa-miR-8080	PAR-CLIP	23592263
MIRT476790	hsa-miR-6816-3p	PAR-CLIP	23592263
MIRT476789	hsa-miR-8083	PAR-CLIP	23592263
MIRT476787	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT476788	hsa-miR-6854-3p	PAR-CLIP	23592263
MIRT476786	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT476785	hsa-miR-548v	PAR-CLIP	23592263
MIRT476784	hsa-miR-6077	PAR-CLIP	23592263
MIRT476783	hsa-miR-19a-5p	PAR-CLIP	23592263
MIRT476782	hsa-miR-19b-1-5p	PAR-CLIP	23592263
MIRT476781	hsa-miR-19b-2-5p	PAR-CLIP	23592263
MIRT476780	hsa-miR-5581-3p	PAR-CLIP	23592263
MIRT476779	hsa-miR-937-5p	PAR-CLIP	23592263
MIRT476778	hsa-miR-627-5p	PAR-CLIP	23592263
MIRT476777	hsa-miR-5089-3p	PAR-CLIP	23592263
MIRT476776	hsa-miR-8081	PAR-CLIP	23592263
MIRT476775	hsa-miR-6885-3p	PAR-CLIP	23592263
MIRT476774	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT476773	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT007254	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT476772	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT476770	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT476771	hsa-miR-3065-3p	PAR-CLIP	23592263
MIRT476769	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT476768	hsa-miR-4530	PAR-CLIP	23592263
MIRT476767	hsa-miR-338-3p	PAR-CLIP	23592263
MIRT1001050	hsa-miR-101	CLIP-seq
MIRT1001051	hsa-miR-1202	CLIP-seq
MIRT1001052	hsa-miR-1244	CLIP-seq
MIRT1001053	hsa-miR-1253	CLIP-seq
MIRT1001054	hsa-miR-1297	CLIP-seq
MIRT1001055	hsa-miR-1304	CLIP-seq
MIRT1001056	hsa-miR-144	CLIP-seq
MIRT1001057	hsa-miR-149	CLIP-seq
MIRT1001058	hsa-miR-155	CLIP-seq
MIRT1001059	hsa-miR-181a	CLIP-seq
MIRT1001060	hsa-miR-181b	CLIP-seq
MIRT1001061	hsa-miR-181c	CLIP-seq
MIRT1001062	hsa-miR-181d	CLIP-seq
MIRT1001063	hsa-miR-199a-3p	CLIP-seq
MIRT1001064	hsa-miR-199b-3p	CLIP-seq
MIRT1001065	hsa-miR-2053	CLIP-seq
MIRT1001066	hsa-miR-24	CLIP-seq
MIRT1001067	hsa-miR-26a	CLIP-seq
MIRT1001068	hsa-miR-26b	CLIP-seq
MIRT1001069	hsa-miR-29a	CLIP-seq
MIRT1001070	hsa-miR-29b	CLIP-seq
MIRT1001071	hsa-miR-29c	CLIP-seq
MIRT1001072	hsa-miR-3065-5p	CLIP-seq
MIRT1001073	hsa-miR-3129-5p	CLIP-seq
MIRT1001074	hsa-miR-3140-3p	CLIP-seq
MIRT1001075	hsa-miR-3143	CLIP-seq
MIRT1001076	hsa-miR-3160-5p	CLIP-seq
MIRT1001077	hsa-miR-3185	CLIP-seq
MIRT1001078	hsa-miR-3201	CLIP-seq
MIRT1001079	hsa-miR-323-3p	CLIP-seq
MIRT1001080	hsa-miR-3616-5p	CLIP-seq
MIRT1001081	hsa-miR-3647-3p	CLIP-seq
MIRT1001082	hsa-miR-3647-5p	CLIP-seq
MIRT1001083	hsa-miR-3692	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1001085	hsa-miR-3921	CLIP-seq
MIRT1001086	hsa-miR-3927	CLIP-seq
MIRT1001087	hsa-miR-3972	CLIP-seq
MIRT1001088	hsa-miR-4262	CLIP-seq
MIRT1001089	hsa-miR-4263	CLIP-seq
MIRT1001090	hsa-miR-4267	CLIP-seq
MIRT1001091	hsa-miR-4272	CLIP-seq
MIRT1001092	hsa-miR-4284	CLIP-seq
MIRT1001093	hsa-miR-4311	CLIP-seq
MIRT1001094	hsa-miR-4465	CLIP-seq
MIRT1001095	hsa-miR-4637	CLIP-seq
MIRT1001096	hsa-miR-4643	CLIP-seq
MIRT1001097	hsa-miR-4650-3p	CLIP-seq
MIRT1001098	hsa-miR-4650-5p	CLIP-seq
MIRT1001099	hsa-miR-4653-5p	CLIP-seq
MIRT1001100	hsa-miR-4668-3p	CLIP-seq
MIRT1001101	hsa-miR-4709-3p	CLIP-seq
MIRT1001102	hsa-miR-4712-3p	CLIP-seq
MIRT1001103	hsa-miR-4717-3p	CLIP-seq
MIRT1001104	hsa-miR-4755-3p	CLIP-seq
MIRT1001105	hsa-miR-4761-5p	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1001107	hsa-miR-4791	CLIP-seq
MIRT1001108	hsa-miR-4795-5p	CLIP-seq
MIRT1001109	hsa-miR-4802-3p	CLIP-seq
MIRT1001110	hsa-miR-498	CLIP-seq
MIRT1001111	hsa-miR-548ae	CLIP-seq
MIRT1001112	hsa-miR-548aj	CLIP-seq
MIRT1001113	hsa-miR-548am	CLIP-seq
MIRT1001114	hsa-miR-548x	CLIP-seq
MIRT1001115	hsa-miR-569	CLIP-seq
MIRT1001116	hsa-miR-573	CLIP-seq
MIRT1001117	hsa-miR-576-5p	CLIP-seq
MIRT1001118	hsa-miR-597	CLIP-seq
MIRT1001119	hsa-miR-603	CLIP-seq
MIRT1001120	hsa-miR-606	CLIP-seq
MIRT1001121	hsa-miR-627	CLIP-seq
MIRT1001122	hsa-miR-634	CLIP-seq
MIRT1001123	hsa-miR-653	CLIP-seq
MIRT1001124	hsa-miR-668	CLIP-seq
MIRT1001125	hsa-miR-802	CLIP-seq
MIRT1001126	hsa-miR-873	CLIP-seq
MIRT1548880	hsa-miR-221	CLIP-seq
MIRT1548881	hsa-miR-222	CLIP-seq
MIRT1001050	hsa-miR-101	CLIP-seq
MIRT1001051	hsa-miR-1202	CLIP-seq
MIRT1996575	hsa-miR-1207-3p	CLIP-seq
MIRT1001052	hsa-miR-1244	CLIP-seq
MIRT1996576	hsa-miR-1292	CLIP-seq
MIRT1001054	hsa-miR-1297	CLIP-seq
MIRT1996577	hsa-miR-1298	CLIP-seq
MIRT1001055	hsa-miR-1304	CLIP-seq
MIRT1996578	hsa-miR-142-5p	CLIP-seq
MIRT1001056	hsa-miR-144	CLIP-seq
MIRT1001059	hsa-miR-181a	CLIP-seq
MIRT1001060	hsa-miR-181b	CLIP-seq
MIRT1001061	hsa-miR-181c	CLIP-seq
MIRT1001062	hsa-miR-181d	CLIP-seq
MIRT1001063	hsa-miR-199a-3p	CLIP-seq
MIRT1001064	hsa-miR-199b-3p	CLIP-seq
MIRT1001065	hsa-miR-2053	CLIP-seq
MIRT1548880	hsa-miR-221	CLIP-seq
MIRT1548881	hsa-miR-222	CLIP-seq
MIRT1001067	hsa-miR-26a	CLIP-seq
MIRT1001068	hsa-miR-26b	CLIP-seq
MIRT1996579	hsa-miR-28-3p	CLIP-seq
MIRT1001069	hsa-miR-29a	CLIP-seq
MIRT1001070	hsa-miR-29b	CLIP-seq
MIRT1001071	hsa-miR-29c	CLIP-seq
MIRT1001072	hsa-miR-3065-5p	CLIP-seq
MIRT1001073	hsa-miR-3129-5p	CLIP-seq
MIRT1001074	hsa-miR-3140-3p	CLIP-seq
MIRT1001075	hsa-miR-3143	CLIP-seq
MIRT1996580	hsa-miR-3148	CLIP-seq
MIRT1001076	hsa-miR-3160-5p	CLIP-seq
MIRT1001077	hsa-miR-3185	CLIP-seq
MIRT1001078	hsa-miR-3201	CLIP-seq
MIRT1001079	hsa-miR-323-3p	CLIP-seq
MIRT1996581	hsa-miR-329	CLIP-seq
MIRT1001080	hsa-miR-3616-5p	CLIP-seq
MIRT1996582	hsa-miR-3618	CLIP-seq
MIRT1996583	hsa-miR-362-3p	CLIP-seq
MIRT1001081	hsa-miR-3647-3p	CLIP-seq
MIRT1001082	hsa-miR-3647-5p	CLIP-seq
MIRT1996584	hsa-miR-3650	CLIP-seq
MIRT1996585	hsa-miR-3671	CLIP-seq
MIRT1996586	hsa-miR-3688-3p	CLIP-seq
MIRT1001083	hsa-miR-3692	CLIP-seq
MIRT1996587	hsa-miR-369-3p	CLIP-seq
MIRT1996588	hsa-miR-374a	CLIP-seq
MIRT1996589	hsa-miR-374b	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1996590	hsa-miR-3914	CLIP-seq
MIRT1001085	hsa-miR-3921	CLIP-seq
MIRT1996591	hsa-miR-3941	CLIP-seq
MIRT1001087	hsa-miR-3972	CLIP-seq
MIRT1996592	hsa-miR-3974	CLIP-seq
MIRT1001088	hsa-miR-4262	CLIP-seq
MIRT1001089	hsa-miR-4263	CLIP-seq
MIRT1001090	hsa-miR-4267	CLIP-seq
MIRT1001091	hsa-miR-4272	CLIP-seq
MIRT1996593	hsa-miR-431	CLIP-seq
MIRT1996594	hsa-miR-432	CLIP-seq
MIRT1001094	hsa-miR-4465	CLIP-seq
MIRT1996595	hsa-miR-4471	CLIP-seq
MIRT1001096	hsa-miR-4643	CLIP-seq
MIRT1996596	hsa-miR-4646-5p	CLIP-seq
MIRT1001099	hsa-miR-4653-5p	CLIP-seq
MIRT1996597	hsa-miR-4666-3p	CLIP-seq
MIRT1001100	hsa-miR-4668-3p	CLIP-seq
MIRT1996598	hsa-miR-4700-3p	CLIP-seq
MIRT1001101	hsa-miR-4709-3p	CLIP-seq
MIRT1001103	hsa-miR-4717-3p	CLIP-seq
MIRT1996599	hsa-miR-4720-3p	CLIP-seq
MIRT1001104	hsa-miR-4755-3p	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1001107	hsa-miR-4791	CLIP-seq
MIRT1996600	hsa-miR-4793-3p	CLIP-seq
MIRT1001108	hsa-miR-4795-5p	CLIP-seq
MIRT1001109	hsa-miR-4802-3p	CLIP-seq
MIRT1996601	hsa-miR-4804-3p	CLIP-seq
MIRT1001110	hsa-miR-498	CLIP-seq
MIRT1996602	hsa-miR-501-3p	CLIP-seq
MIRT1996603	hsa-miR-502-3p	CLIP-seq
MIRT1996604	hsa-miR-513a-3p	CLIP-seq
MIRT1996605	hsa-miR-548a-3p	CLIP-seq
MIRT1996606	hsa-miR-548ad	CLIP-seq
MIRT1001111	hsa-miR-548ae	CLIP-seq
MIRT1001112	hsa-miR-548aj	CLIP-seq
MIRT1001113	hsa-miR-548am	CLIP-seq
MIRT1996607	hsa-miR-548e	CLIP-seq
MIRT1996608	hsa-miR-548f	CLIP-seq
MIRT1996609	hsa-miR-548g	CLIP-seq
MIRT1001114	hsa-miR-548x	CLIP-seq
MIRT1001115	hsa-miR-569	CLIP-seq
MIRT1001116	hsa-miR-573	CLIP-seq
MIRT1001117	hsa-miR-576-5p	CLIP-seq
MIRT1001118	hsa-miR-597	CLIP-seq
MIRT1001119	hsa-miR-603	CLIP-seq
MIRT1996610	hsa-miR-607	CLIP-seq
MIRT1001121	hsa-miR-627	CLIP-seq
MIRT1001122	hsa-miR-634	CLIP-seq
MIRT1001123	hsa-miR-653	CLIP-seq
MIRT1001124	hsa-miR-668	CLIP-seq
MIRT1001125	hsa-miR-802	CLIP-seq
MIRT1001126	hsa-miR-873	CLIP-seq
MIRT1996576	hsa-miR-1292	CLIP-seq
MIRT1996577	hsa-miR-1298	CLIP-seq
MIRT1001075	hsa-miR-3143	CLIP-seq
MIRT1001079	hsa-miR-323-3p	CLIP-seq
MIRT1996581	hsa-miR-329	CLIP-seq
MIRT1996583	hsa-miR-362-3p	CLIP-seq
MIRT1996585	hsa-miR-3671	CLIP-seq
MIRT1001083	hsa-miR-3692	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1996591	hsa-miR-3941	CLIP-seq
MIRT1001089	hsa-miR-4263	CLIP-seq
MIRT1996595	hsa-miR-4471	CLIP-seq
MIRT1996596	hsa-miR-4646-5p	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1001117	hsa-miR-576-5p	CLIP-seq
MIRT1001119	hsa-miR-603	CLIP-seq
MIRT1996610	hsa-miR-607	CLIP-seq
MIRT1001125	hsa-miR-802	CLIP-seq
MIRT1001059	hsa-miR-181a	CLIP-seq
MIRT1001060	hsa-miR-181b	CLIP-seq
MIRT1001061	hsa-miR-181c	CLIP-seq
MIRT1001062	hsa-miR-181d	CLIP-seq
MIRT1001065	hsa-miR-2053	CLIP-seq
MIRT1001072	hsa-miR-3065-5p	CLIP-seq
MIRT1001084	hsa-miR-383	CLIP-seq
MIRT1001088	hsa-miR-4262	CLIP-seq
MIRT1001106	hsa-miR-4772-5p	CLIP-seq
MIRT1996605	hsa-miR-548a-3p	CLIP-seq
MIRT1996607	hsa-miR-548e	CLIP-seq
MIRT1996608	hsa-miR-548f	CLIP-seq
MIRT1996609	hsa-miR-548g	CLIP-seq
MIRT1001115	hsa-miR-569	CLIP-seq

Transcription factors

Show/Hide all(36)

Transcription factor	Regulation	Reference
AHR	Unknown	10478842
ARNT	Repression	21544813
BRCA1	Unknown	11313879
CREB1	Unknown	12432566
CREM	Repression	21757709
DACH1	Repression	17182846
ELK1	Unknown	11313879;11846562;20682780
ELK4	Activation	9734357
ELK4	Unknown	11846562
ESR1	Unknown	10037443
ESR2	Unknown	10037443
FOS	Repression	2498646
HDAC1	Repression	17056544
HMGN1	Unknown	17938209
HOPX	Repression	19173292
HSF2	Unknown	17915561
MITF	Activation	14737107
NCOA6	Activation	19329434
NF1	Activation	9562250
NFYB	Unknown	23595228
NFYC	Unknown	23595228
NKX3-1	Repression	22179513
RB1	Repression	1909121
RB1	Unknown	7680889
RBMX	Repression	16707624
SMARCA4	Repression	10082538
SP1	Unknown	9528985
SRF	Activation	10742173;9734357
SRF	Unknown	11846562;2200737;2493627
STAT3	Activation	12600988;14737107;17204573
STAT6	Activation	11922943
STAT6	Unknown	18342537
TBP	Activation	15767669
TWIST1	Activation	19051271
TWIST2	Activation	19051271
ZBTB7A	Repression	17189472

Show/Hide all(110)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	9732876
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	30670568
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IMP	10704222
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	10523647
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	30670568
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001661	Process	Conditioned taste aversion	IEA
GO:0003407	Process	Neural retina development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9732876
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	10704222
GO:0005515	Function	Protein binding	IPI	7816143, 12788789, 16511568, 18172215, 19028685, 19064921, 20102225, 20195357, 20211142, 20511396, 20936779, 21199371, 22308434, 23602568, 23661758, 24029232, 25241761, 25609649, 26496610, 28514442, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 35140242, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9443941, 12370307, 22387553, 24184327
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005634	Component	Nucleus	TAS	9443941
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8628277
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	9510247, 20102225, 23661758
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10918580
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10918580
GO:0006954	Process	Inflammatory response	TAS	9443941
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9732876
GO:0007399	Process	Nervous system development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009416	Process	Response to light stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009629	Process	Response to gravity	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014823	Process	Response to activity	IEA
GO:0014856	Process	Skeletal muscle cell proliferation	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0032993	Component	Protein-DNA complex	IMP	10704222
GO:0034097	Process	Response to cytokine	IEA
GO:0034224	Process	Cellular response to zinc ion starvation	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	17217916
GO:0035902	Process	Response to immobilization stress	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IMP	26514923
GO:0035976	Component	Transcription factor AP-1 complex	IPI	7816143, 9510247
GO:0035994	Process	Response to muscle stretch	IEA
GO:0042802	Function	Identical protein binding	IPI	23661758, 25609649
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9732876
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10508860
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	10523647
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	10704222
GO:0048545	Process	Response to steroid hormone	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	9732876
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10508860
GO:0070412	Function	R-SMAD binding	IPI	9732876
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0072375	Process	Medium-term memory	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	30670568
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1903131	Process	Mononuclear cell differentiation	IEA
GO:1904321	Process	Response to forskolin	IEA
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IEA
GO:1990646	Process	Cellular response to prolactin	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
164810	3796	ENSG00000170345

Protein

UniProt ID

P01100

Protein name

Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos)

Protein function

Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activatio

PDB

1A02 , 1FOS , 1S9K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	135 → 197	bZIP transcription factor	Coiled-coil

Sequence

MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway cAMP signaling pathway Apoptosis Osteoclast differentiation Toll-like receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway B cell receptor signaling pathway TNF signaling pathway Circadian entrainment Cholinergic synapse Dopaminergic synapse Estrogen signaling pathway Prolactin signaling pathway Oxytocin signaling pathway Relaxin signaling pathway Parathyroid hormone synthesis, secretion and action Non-alcoholic fatty liver disease Growth hormone synthesis, secretion and action Amphetamine addiction Pathogenic Escherichia coli infection Salmonella infection Pertussis Yersinia infection Leishmaniasis Chagas disease Hepatitis B Measles Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Pathways in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Colorectal cancer Breast cancer Choline metabolism in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Rheumatoid arthritis Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) FCERI mediated MAPK activation Activation of the AP-1 family of transcription factors Interleukin-4 and Interleukin-13 signaling TP53 Regulates Transcription of DNA Repair Genes Estrogen-dependent gene expression NGF-stimulated transcription Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Lipodystrophy	Berardinelli-Seip congenital lipodystrophy	N/A	N/A	GenCC

Show/Hide Text Mining Associations (281)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidosis	Stimulate	40217316
Acro Osteolysis	Associate	35145077
Adenocarcinoma	Associate	26786102
Adenocarcinoma Follicular	Inhibit	2803926
Adenocarcinoma of Lung	Associate	23591077, 31698633, 35029906
Adenoma	Associate	3348948
Adenomyosis	Associate	32933042
Altitude Sickness	Inhibit	33393628
Alzheimer Disease	Stimulate	17712163
Alzheimer Disease	Associate	9880041
Aniridia	Associate	32422284
Aortic Valve Stenosis	Associate	39766890
Arthritis	Associate	8601460, 9421489
Arthritis Psoriatic	Associate	37965313
Arthritis Rheumatoid	Associate	23684916, 24089231, 27572279, 30893847, 31178673, 36439145, 8660103, 9613344
Asthma	Associate	9854051
Astrocytoma	Associate	1322154, 1902475, 19320777
Astrocytoma	Stimulate	27229157
Atherosclerosis	Associate	15728378
Atrial Fibrillation	Associate	29940585
Autoimmune Diseases	Associate	32042069, 34267747
Barrett Esophagus	Associate	1398227
Biotin deficiency	Associate	15987846
Bipolar Disorder	Associate	19488045
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Blood Coagulation Disorders	Associate	19652200
Bone Diseases	Associate	11398843, 33034932
Bone Neoplasms	Associate	11398843, 36426824
Brain Neoplasms	Associate	23301044
Breast Neoplasms	Associate	15090535, 15607537, 15746191, 18826606, 18928543, 1906001, 1922031, 20537635, 21167036, 21655091, 23135268, 23301044, 25824986, 26179713, 26415222 View all (15 more)
Breast Neoplasms	Inhibit	33742056
Bronchiolitis Obliterans Syndrome	Associate	37965310
Bursitis	Associate	36875119
Calcinosis	Associate	15728378
Calcinosis Cutis	Associate	25764026
Carcinogenesis	Associate	11570575, 15507668, 15746191, 16475721, 18978706, 21496227, 24296757, 26581505, 28811522, 29150442, 29422527, 33836600, 33941222
Carcinoma Basal Cell	Inhibit	11348463
Carcinoma Ductal	Associate	23609359
Carcinoma Ductal Breast	Associate	23083134, 23301044
Carcinoma Hepatocellular	Associate	15078869, 16038047, 1661347, 17278226, 19009649, 21862593, 23844083, 29391759, 31543683, 32280695, 32815653, 34238253, 37723590, 9030721
Carcinoma Hepatocellular	Inhibit	30228980
Carcinoma Non Small Cell Lung	Associate	12177790
Carcinoma Non Small Cell Lung	Stimulate	1718163
Carcinoma Ovarian Epithelial	Inhibit	18854825
Carcinoma Ovarian Epithelial	Associate	29130097
Carcinoma Papillary	Inhibit	10504000
Carcinoma Squamous Cell	Associate	10935492, 14966901, 18978706, 21822357, 24356192, 29582647, 9484827
Cardiomyopathy Dilated	Associate	30368515
Cataract	Associate	32534225
Cataract Age Related Nuclear	Associate	32534225
Cell Transformation Neoplastic	Associate	11359772
Cell Transformation Neoplastic	Stimulate	18219112
Cerebellar Diseases	Associate	40445405
Cerebral Infarction	Associate	25135788, 28834871, 37268894, 40629591
Chlamydophila Infections	Associate	23163821
Cholangiocarcinoma	Associate	31795085
Chondrosarcoma	Associate	11398843
Chordoma	Associate	34330313
Choriocarcinoma	Associate	18362896
Colitis Ulcerative	Associate	24118792, 26461477
Colonic Neoplasms	Associate	18032824
Colorectal Neoplasms	Associate	16207476, 26222778, 26461477, 31261535, 34337040, 36698183, 38233377
Colorectal Neoplasms	Stimulate	23588207
Corneal Dystrophy Band Shaped	Associate	32422284
Coronary Aneurysm	Associate	14521609
Coronary Disease	Associate	33849106, 40184077
COVID 19	Associate	35718334, 36380355
COVID 19	Stimulate	37936693
Depressive Disorder	Stimulate	23720503
Dermatitis Atopic	Associate	11121152
Diabetes Mellitus	Associate	28739185
Diabetes Mellitus Type 1	Associate	30476653
Diabetic Cardiomyopathies	Associate	34926700
Diabetic Nephropathies	Inhibit	35721731
Diabetic Nephropathies	Associate	35991124, 36329882, 36585417, 37396184
Diastrophic dysplasia	Associate	22820187
Disease	Associate	14519134
Drug Related Side Effects and Adverse Reactions	Stimulate	27490694
Dwarfism Pituitary	Associate	27651465
Encephalocele	Associate	12384753
Endometrial Neoplasms	Associate	10393530, 11570575, 22706224, 23530112, 25153722, 8701784
Endometriosis	Stimulate	17888430
Endometriosis	Associate	32240297, 33033989, 38456992
Epilepsy	Associate	17910586
Epilepsy Partial with Variable Foci	Stimulate	17910586
Epstein Barr Virus Infections	Associate	23625009
Esophageal Neoplasms	Associate	14966901, 26858249, 27906434, 36569220
Esophageal Squamous Cell Carcinoma	Associate	24052437, 31277149, 36466860
Fasciitis	Associate	33318581
Fatty Liver	Inhibit	38072306
Fibroma Desmoplastic	Associate	36426824
Fibroma Ossifying	Associate	36928741
Fibromyalgia	Associate	32083545
Fibrous Dysplasia of Bone	Associate	39766890, 7739708
Focal Epithelial Hyperplasia of the Oral Mucosa	Associate	16050486, 29582647
Fractures Bone	Associate	32454462
Gastroesophageal Reflux	Associate	24706321
Gerodermia osteodysplastica	Stimulate	3257396
Giant Cell Tumor of Bone	Associate	25764026
Giant Cell Tumor of Tendon Sheath	Associate	32108038
Glaucoma Open Angle	Associate	36727359
Glioblastoma	Associate	12468535, 15831677, 24732116, 35538663
Glioma	Associate	27602752, 8910439
Glomerulonephritis IGA	Associate	1712408, 24652774, 27127888, 31392215, 32791747, 38278877
Glucosephosphate Dehydrogenase Deficiency	Associate	31707353
Glycosuria Renal	Associate	9497315
Gout	Associate	35524416, 35813414
Guillain Barre Syndrome	Associate	22253732
Haspeslagh Fryns Muelenaere syndrome	Associate	36099089
Heart Diseases	Associate	37268894
Heart Failure	Associate	30368515, 36859608, 37334672
Hemangioma	Associate	26135557, 29150442, 33034932, 33318580, 38189436
Hemangiosarcoma	Associate	31305404
Hematologic Neoplasms	Associate	3499189
Hemolytic Uremic Syndrome	Associate	37795100
Hepatitis C	Associate	23844083
Hereditary leiomyomatosis and renal cell cancer	Associate	1731522, 25139349
HIV Infections	Associate	22280894, 34249000
Hypersensitivity Immediate	Associate	18923650
Hypertension	Associate	20359597, 37675573
Hypertension Renal	Associate	24085434
Hypoxia	Stimulate	12737630, 18826606, 8065332, 9287359
Hypoxia	Associate	15211754, 8536713
Hypoxia Brain	Associate	8065332
Hypoxia Brain	Stimulate	9287359
Idiopathic Pulmonary Fibrosis	Associate	34972106
IgA Vasculitis	Associate	11056662, 9613344
Immune System Diseases	Associate	32083545
Immunologic Deficiency Syndromes	Associate	11260070
Infections	Associate	15270850
Infections	Stimulate	23797008, 9094704
Inflammation	Associate	15375172, 15728378, 23163821, 23760290, 24500404, 26135557, 26461477, 27513856, 27668889, 27956552, 28739185, 30440036, 30476653, 31087647, 33662681 View all (11 more)
Inflammation	Stimulate	8660103
Intervertebral Disc Degeneration	Associate	32572902
Intervertebral disc disease	Associate	12384753
Intervertebral Disc Displacement	Associate	12384753
Ischemic Stroke	Associate	25135788
Kashin Beck Disease	Associate	30153510
Kidney Diseases	Associate	11576350, 24652774
Laryngeal Neoplasms	Associate	29483928
Leiomyoma	Associate	15228428, 18692824, 32108038, 7997802
Leukemia	Associate	10713077, 19444595, 2506946, 2910363, 3276363, 3499189, 3520570, 3539224
Leukemia B Cell	Associate	3499189
Leukemia Hairy Cell	Associate	3530350
Leukemia Lymphocytic Chronic B Cell	Associate	16322480, 2312171, 23936412, 2496772, 3099293, 3257396
Leukemia Lymphocytic Chronic B Cell	Stimulate	26509439
Leukemia Lymphoid	Associate	3499189
Leukemia Lymphoma Adult T Cell	Associate	1527057, 37832654
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26460262
Leukemia Myeloid	Associate	2174893, 3547082
Leukemia Myeloid Acute	Associate	24867525, 25340776, 3499189
Leukemia Myelomonocytic Acute	Associate	3276363
Leukemia Prolymphocytic T Cell	Associate	3106089
Leukemia Promyelocytic Acute	Associate	2834348
Leukemia T Cell	Associate	26011749
Leukocyte adhesion deficiency type 1	Associate	31201998
Leukoplakia	Associate	38408418
Limb girdle muscular dystrophy type 2A	Associate	19015733
Limbal Stem Cell Deficiency	Associate	32422284
Lipodystrophy Congenital Generalized	Associate	23919306
Lipoma	Associate	32108038
Lipomatosis Multiple Symmetrical	Associate	28901441
Livedoid Vasculopathy	Associate	37965310
Liver Cirrhosis	Associate	28355233
Liver Cirrhosis Biliary	Associate	10913062, 8601460
Lung Diseases	Associate	32457348, 34972106
Lung Neoplasms	Associate	22363436, 24132637, 28811522, 36224313
Lupus Erythematosus Systemic	Associate	15322221, 21757709
Lupus Erythematosus Systemic	Inhibit	3701256, 9822266
Lymphatic Metastasis	Inhibit	18158562
Lymphatic Metastasis	Associate	24052437, 33441952
Lymphoma	Associate	37569769
Lymphoma B Cell	Associate	3499189
Lymphoma B Cell Marginal Zone	Associate	15507668
Lymphoma Large B Cell Diffuse	Associate	35522945, 35604882
Lymphoma Large Cell Anaplastic	Associate	20511667
Lymphoma Non Hodgkin	Associate	15831677
Lymphoma T Cell	Associate	22510872
Lymphoma T Cell Cutaneous	Associate	9864169
Malformations of Cortical Development Group I	Associate	36431966
Melanoma	Associate	1372901, 14519134, 14717848, 16116595, 1712822, 23400877, 25695333, 33373316, 35926467, 8836133
Mental Disorders	Associate	32083545, 7708933
Mesenchymoma	Associate	36426824
Mesothelioma Malignant	Associate	19815709
Midline granulomatosis	Associate	21652721
Migraine with Aura	Stimulate	23720503
Mitochondrial Diseases	Associate	33097606
Mood Disorders	Associate	25451397
Mouth Diseases	Associate	11398843, 18978706
Mouth Neoplasms	Associate	18978706
Mouth Neoplasms	Inhibit	29582647
Multiple Myeloma	Associate	28487543, 28835615, 33963182, 36251145
Muscular Atrophy	Associate	39354574
Musculoskeletal Diseases	Associate	11398843, 32083545
Myelodysplastic Syndromes	Associate	23320102, 23593403, 27513856, 34944006
Myocardial Infarction	Associate	34799616, 37334672
Myocardial Infarction	Stimulate	40685440
Myositis	Associate	33318581
Myxoma	Associate	19320777
Nasal Polyps	Associate	9797757
Neoplasm Metastasis	Associate	27602752, 9287359
Neoplasms	Associate	10913062, 10935492, 12547826, 14966901, 15228428, 18435575, 1922053, 19320777, 19758438, 20174585, 20332213, 20551291, 21668942, 23135268, 23301044 View all (43 more)
Neoplasms	Stimulate	11570575, 18986987, 8947050
Neoplasms	Inhibit	18158562, 18763282, 18854825, 23163821, 24073962, 2803926
Nephrotic Syndrome	Associate	28433687
Neuroblastoma	Associate	17409494, 1902412
Neuroendocrine Tumors	Associate	36307579
Non alcoholic Fatty Liver Disease	Associate	33324350, 36380355
Obesity	Associate	24558408
Oncogene Addiction	Associate	17167184, 8836133
Oropharyngeal Neoplasms	Associate	15375172
Osteoarthritis	Associate	27866912, 28256567, 30081074, 36619785, 38090564, 38401067
Osteoarthritis Knee	Associate	30893847
Osteoblastoma	Associate	31768625, 32108038, 32542935, 35347251
Osteoma Osteoid	Associate	31768625, 35347251
Osteosarcoma	Associate	17412493, 28665975
Ovarian Neoplasms	Inhibit	18854825
Ovarian Neoplasms	Associate	2113532, 28407786, 29130097, 34737212, 8168613
Pain	Associate	16703977
Pain	Stimulate	22875918
Pancreatic Neoplasms	Associate	10217407, 18832796, 25789763, 30696421, 30767554
Periodontitis	Associate	36389665
Pituitary Neoplasms	Associate	31655798
Pneumonia	Associate	23163821, 24132637
Polyposis Syndrome Hereditary Mixed 1	Inhibit	36698183
Precancerous Conditions	Associate	12547826, 14966901, 33649793
Prostatic Hyperplasia	Associate	24500928
Prostatic Neoplasms	Associate	10864209, 19123467, 24499138, 25281873, 30483762, 9166941
Prostatic Neoplasms Castration Resistant	Associate	23319273
Psoriasis	Inhibit	1940437
Psoriasis	Associate	38115636
Pterygium	Associate	32645133, 36187094
Pulmonary edema of mountaineers	Associate	33393628
Pulpitis	Associate	33777260
Renal Insufficiency Chronic	Associate	29642064
Reperfusion Injury	Stimulate	30186861
Retinal Dysplasia	Stimulate	14966901
Retinal Dysplasia	Associate	18978706
Retinoblastoma	Associate	8230424
Rhabdomyosarcoma	Associate	23797008
Rhabdomyosarcoma Alveolar	Associate	35879366
Rhinitis Allergic	Associate	34383804
Salivary Gland Neoplasms	Associate	8456948
Sarcoma Ewing	Associate	37599787, 39201282
Sarcoma Kaposi	Associate	25903346
Schizophrenia	Associate	25658856, 31175266
Scleroderma Systemic	Stimulate	30312535
Scleroderma Systemic	Associate	31178673
Seizures	Associate	33388373
Skin Neoplasms	Associate	8120411
Squamous Cell Carcinoma of Head and Neck	Associate	16050486, 24466237, 25945837, 27349552, 35211756
Status Asthmaticus	Stimulate	20926789
Stomach Neoplasms	Associate	14606069, 16769709, 18158562, 21047770, 28058586, 28169308, 30266078, 31380415, 33441952, 36171622, 36609277, 36615849, 37460253, 8612619
Stroke	Associate	25135788, 32626985
Sudden Unexpected Death in Epilepsy	Associate	35716147
Synovial Cyst	Associate	10913062
Synovitis	Associate	29968759
Systemic Vasculitis	Associate	28440408
Tertiary Lymphoid Structures	Stimulate	9484827
Testicular Germ Cell Tumor	Associate	17167184
Thrombosis	Associate	37460318
Thyroid Cancer Papillary	Inhibit	10504000
Thyroid Cancer Papillary	Associate	30358208
Thyroid Neoplasms	Associate	3348948
Thyroiditis	Associate	2803926
Tongue Diseases	Associate	26581505
Tongue Neoplasms	Associate	26581505
Tooth Resorption	Associate	37793008
Triple Negative Breast Neoplasms	Associate	29273624, 33533919, 35355564, 39206896
Tuberculosis Multidrug Resistant	Associate	7972021
Uremia	Associate	34858433, 37795100
Urethral Neoplasms	Stimulate	16475721
Urinary Bladder Neoplasms	Associate	25865820, 28358415, 29518027, 29532898
Uterine Cervical Neoplasms	Stimulate	15514944
Uterine Cervical Neoplasms	Associate	15548518, 21496227, 21937452, 22405256, 24987920, 29073938, 34151839, 35503086, 36431966, 8985358
Uterine Cervicitis	Associate	15514944
Uterine Diseases	Associate	15228428
Varicose Ulcer	Stimulate	32360331
Vascular Diseases	Associate	34858433
Weight Loss	Inhibit	21147860
Xeroderma Pigmentosum Complementation Group G	Associate	26149386

FOS (Fos proto-oncogene, AP-1 transcription factor subunit)