Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23529
Gene name	Cardiotrophin like cytokine factor 1
Gene symbol	CLCF1
Synonyms (NCBI Gene)	BSF-3BSF3CISS2CLCNNT-1NNT1NR6
Chromosome	11
Chromosome location	11q13.2
Summary	This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic facto

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440940	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440940	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT894537	hsa-miR-3158-3p	CLIP-seq
MIRT894538	hsa-miR-412	CLIP-seq
MIRT894539	hsa-miR-4481	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT894541	hsa-miR-4693-3p	CLIP-seq
MIRT894542	hsa-miR-4745-5p	CLIP-seq
MIRT894543	hsa-miR-4758-5p	CLIP-seq
MIRT894544	hsa-miR-486-3p	CLIP-seq
MIRT894545	hsa-miR-603	CLIP-seq
MIRT1965277	hsa-miR-1207-5p	CLIP-seq
MIRT1965278	hsa-miR-1236	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT1965279	hsa-miR-1914	CLIP-seq
MIRT1965280	hsa-miR-2053	CLIP-seq
MIRT1965281	hsa-miR-218	CLIP-seq
MIRT1965282	hsa-miR-299-5p	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT1965283	hsa-miR-3160-5p	CLIP-seq
MIRT1965284	hsa-miR-3166	CLIP-seq
MIRT1965285	hsa-miR-3918	CLIP-seq
MIRT1965286	hsa-miR-4283	CLIP-seq
MIRT1965287	hsa-miR-4436b-3p	CLIP-seq
MIRT894539	hsa-miR-4481	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965288	hsa-miR-4489	CLIP-seq
MIRT1965289	hsa-miR-4492	CLIP-seq
MIRT1965290	hsa-miR-4498	CLIP-seq
MIRT1965291	hsa-miR-4505	CLIP-seq
MIRT1965292	hsa-miR-4512	CLIP-seq
MIRT1965293	hsa-miR-4731-5p	CLIP-seq
MIRT894542	hsa-miR-4745-5p	CLIP-seq
MIRT1965294	hsa-miR-4753-3p	CLIP-seq
MIRT1965295	hsa-miR-4761-3p	CLIP-seq
MIRT1965296	hsa-miR-4763-3p	CLIP-seq
MIRT1965297	hsa-miR-4768-5p	CLIP-seq
MIRT1965298	hsa-miR-4771	CLIP-seq
MIRT894544	hsa-miR-486-3p	CLIP-seq
MIRT1965299	hsa-miR-569	CLIP-seq
MIRT894545	hsa-miR-603	CLIP-seq
MIRT1965300	hsa-miR-636	CLIP-seq
MIRT1965301	hsa-miR-637	CLIP-seq
MIRT1965302	hsa-miR-762	CLIP-seq
MIRT1965277	hsa-miR-1207-5p	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT2201219	hsa-miR-2110	CLIP-seq
MIRT2201220	hsa-miR-22	CLIP-seq
MIRT2201221	hsa-miR-3150a-3p	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT894537	hsa-miR-3158-3p	CLIP-seq
MIRT2201222	hsa-miR-3175	CLIP-seq
MIRT2201223	hsa-miR-3189-3p	CLIP-seq
MIRT1965285	hsa-miR-3918	CLIP-seq
MIRT894538	hsa-miR-412	CLIP-seq
MIRT1965286	hsa-miR-4283	CLIP-seq
MIRT2201224	hsa-miR-4300	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965288	hsa-miR-4489	CLIP-seq
MIRT1965289	hsa-miR-4492	CLIP-seq
MIRT1965290	hsa-miR-4498	CLIP-seq
MIRT1965291	hsa-miR-4505	CLIP-seq
MIRT1965292	hsa-miR-4512	CLIP-seq
MIRT2201225	hsa-miR-4715-3p	CLIP-seq
MIRT1965293	hsa-miR-4731-5p	CLIP-seq
MIRT1965296	hsa-miR-4763-3p	CLIP-seq
MIRT894544	hsa-miR-486-3p	CLIP-seq
MIRT2201226	hsa-miR-548an	CLIP-seq
MIRT2201227	hsa-miR-558	CLIP-seq
MIRT1965301	hsa-miR-637	CLIP-seq
MIRT1965302	hsa-miR-762	CLIP-seq
MIRT2201228	hsa-miR-920	CLIP-seq
MIRT2201229	hsa-miR-939	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT894536	hsa-miR-3151	CLIP-seq
MIRT1965286	hsa-miR-4283	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965288	hsa-miR-4489	CLIP-seq
MIRT894535	hsa-miR-1293	CLIP-seq
MIRT894540	hsa-miR-4483	CLIP-seq
MIRT1965291	hsa-miR-4505	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0005102	Function	Signaling receptor binding	IPI	15272019
GO:0005125	Function	Cytokine activity	IDA	10966616
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	10500198
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	IDA	10966616
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	IDA	11285233
GO:0005515	Function	Protein binding	IPI	10966616, 26858303, 29507344
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	10966616
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	10448081
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	ISS
GO:0008083	Function	Growth factor activity	TAS	14632778
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10966616, 11285233
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	10500198
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030890	Process	Positive regulation of B cell proliferation	IBA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	10966616, 11285233
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048295	Process	Positive regulation of isotype switching to IgE isotypes	IEA
GO:0048295	Process	Positive regulation of isotype switching to IgE isotypes	ISS
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	ISS
GO:0097058	Component	CRLF-CLCF1 complex	IBA
GO:0097058	Component	CRLF-CLCF1 complex	IDA	10966616
GO:0097059	Component	CNTFR-CLCF1 complex	IBA
GO:0097059	Component	CNTFR-CLCF1 complex	IDA	11285233
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	10966616, 11285233
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	TAS	14632778

MIM	HGNC	e!Ensembl
607672	17412	ENSG00000175505

Q9UBD9

Protein name

Cardiotrophin-like cytokine factor 1 (B-cell-stimulating factor 3) (BSF-3) (Novel neurotrophin-1) (NNT-1)

Protein function

In complex with CRLF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable). Also stimulates B-cells. Binds to and activates the ILST/gp130 receptor. {ECO:0000269|PubMed:10448081, ECO:000026

PDB

8D7H , 8D7R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06875	PRF	40 → 213	Plethodontid receptivity factor PRF	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver. {ECO:0000269|PubMed:10448081, ECO:0000269|PubMed:10500198}.

Sequence

MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT
YLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL
NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQ
KMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Sequence length

225

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway		IL-6-type cytokine receptor ligand interactions

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cold-induced sweating syndrome 2	Pathogenic	rs104894198, rs104894203, rs137853934, rs137853935	RCV000003064 RCV000003065 RCV000020692 RCV000032768

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CLCF1-related disorder	Likely benign	rs767970190, rs753589757	RCV003914491 RCV003934601
See cases	Uncertain significance	rs771570860	RCV002252390

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	36114746
Bone Diseases	Associate	33430863
Bone Diseases Metabolic	Stimulate	33430863
Colitis Ulcerative	Associate	37891214
Crisponi syndrome	Associate	32512309
Crohn Disease	Associate	37891214
Fever	Associate	32512309
Fractures Bone	Associate	33430863
Glioma	Associate	35265072
Hamartoma Syndrome Multiple	Associate	32512309
Multiple Myeloma	Associate	14632778
Neoplasms	Associate	35265072
Osteoporosis	Inhibit	33430863
Plasmacytoma	Stimulate	14632778

CLCF1 (cardiotrophin like cytokine factor 1)