Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23521
Gene name Gene Name - the full gene name approved by the HGNC.
Ribosomal protein L13a
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPL13A
Synonyms (NCBI Gene) Gene synonyms aliases
L13A, TSTA1, uL13
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050090 hsa-miR-26a-5p CLASH 23622248
MIRT049196 hsa-miR-92a-3p CLASH 23622248
MIRT048145 hsa-miR-197-3p CLASH 23622248
MIRT044446 hsa-miR-320a CLASH 23622248
MIRT040518 hsa-miR-576-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay TAS
GO:0003723 Function RNA binding HDA 22658674
GO:0003729 Function MRNA binding IBA 21873635
GO:0003735 Function Structural constituent of ribosome IBA 21873635
GO:0003735 Function Structural constituent of ribosome NAS 12962325
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619225 10304 ENSG00000142541
Protein
UniProt ID P40429
Protein name Large ribosomal subunit protein uL13 (23 kDa highly basic protein) (60S ribosomal protein L13a)
Protein function Associated with ribosomes but is not required for canonical ribosome function and has extra-ribosomal functions (PubMed:14567916, PubMed:17218275, PubMed:23636399, PubMed:32669547). Component of the GAIT (gamma interferon-activated inhibitor of
PDB 4UG0 , 4V6X , 5AJ0 , 5LKS , 5T2C , 6IP5 , 6IP6 , 6IP8 , 6LQM , 6LSR , 6LSS , 6LU8 , 6OLE , 6OLF , 6OLG , 6OLI , 6OLZ , 6OM0 , 6OM7 , 6QZP , 6W6L , 6XA1 , 6Y0G , 6Y2L , 6Y57 , 6Y6X , 6Z6L , 6Z6M , 6Z6N , 6ZM7 , 6ZME , 6ZMI , 6ZMO , 7BHP , 7F5S , 7OW7 , 7QVP , 7XNX , 7XNY , 8A3D , 8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FKZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00572 Ribosomal_L13 4 111 Ribosomal protein L13 Family
Sequence
MAEVQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRK
RMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPP
YDKKKRMVV
PAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQ
AEKNVEKKIDKYTEVLKTHGLLV
Sequence length 203
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome
Coronavirus disease - COVID-19
  L13a-mediated translational silencing of Ceruloplasmin expression
SRP-dependent cotranslational protein targeting to membrane
Viral mRNA Translation
Major pathway of rRNA processing in the nucleolus and cytosol
Formation of a pool of free 40S subunits
GTP hydrolysis and joining of the 60S ribosomal subunit
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)
27602772
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 30259794
Breast Neoplasms Associate 34907725
Carcinoma Renal Cell Associate 18072593
Depression Postpartum Associate 34856750
Glioblastoma Associate 30259794
Glioma Associate 31870167
Infertility Male Associate 38012716
Intervertebral Disc Degeneration Associate 31124977
Neoplasms Associate 38166541
Sarcoma Kaposi Associate 40016701