FOLR2 (folate receptor beta)

Gene

• Entrez ID: 2350
• Gene name: Folate receptor beta
• Gene symbol: FOLR2
• Synonyms (NCBI Gene): BETA-HFR, FBP, FBP/PL-1, FOLR1, FR-BETA, FR-P3, FRbeta
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017234	hsa-miR-335-5p	Microarray	18185580
MIRT029090	hsa-miR-26b-5p	Microarray	19088304
MIRT2388070	hsa-miR-1225-3p	CLIP-seq
MIRT2388071	hsa-miR-1233	CLIP-seq
MIRT2388072	hsa-miR-3160-3p	CLIP-seq
MIRT2388073	hsa-miR-4265	CLIP-seq
MIRT2388074	hsa-miR-4296	CLIP-seq
MIRT2388075	hsa-miR-4300	CLIP-seq
MIRT2388076	hsa-miR-4322	CLIP-seq
MIRT2388077	hsa-miR-4487	CLIP-seq
MIRT2388078	hsa-miR-4648	CLIP-seq
MIRT2388079	hsa-miR-4654	CLIP-seq
MIRT2388080	hsa-miR-4663	CLIP-seq
MIRT2388081	hsa-miR-4769-5p	CLIP-seq
MIRT2388082	hsa-miR-558	CLIP-seq
MIRT2388083	hsa-miR-579	CLIP-seq
MIRT2388084	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IDA	25015955
GO:0005542	Function	Folic acid binding	IDA	4066659, 19116913, 25015955
GO:0005542	Function	Folic acid binding	IEA
GO:0005542	Function	Folic acid binding	TAS	2605182
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	NAS	25015955
GO:0007155	Process	Cell adhesion	IBA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19116913
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	4066659
GO:0009986	Component	Cell surface	IDA	25015955
GO:0015884	Process	Folic acid transport	IDA	4066659
GO:0015884	Process	Folic acid transport	TAS	2605182
GO:0016020	Component	Membrane	IEA
GO:0035036	Process	Sperm-egg recognition	IBA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0061714	Function	Folic acid receptor activity	IC	4066659
GO:0061714	Function	Folic acid receptor activity	IDA	4066659
GO:0071231	Process	Cellular response to folic acid	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 136425
• HGNC: 3793
• e!Ensembl: ENSG00000165457

Protein

• UniProt ID: P14207
• Protein name: Folate receptor beta (FR-beta) (Folate receptor 2) (Folate receptor, fetal/placental) (Placental folate-binding protein) (FBP)
• Protein function: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH
• PDB: 4KMY, 4KMZ, 4KN0, 4KN1, 4KN2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03024	Folate_rec	30 → 205	Folate receptor family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues. {ECO:0000269|PubMed:2605182, ECO:0000269|PubMed:8445646}.
• Sequence:

  MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
  TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
  ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
  ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
  LLLSLALMLQLWLLG

• Sequence length: 255

Pathways

KEGG:

Antifolate resistance
Endocytosis
Folate transport and metabolism

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins
Metabolism of folate and pterines

<