Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23492
Gene name Gene Name - the full gene name approved by the HGNC.
Chromobox 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CBX7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001104 hsa-miR-421 qRT-PCR, Western blot 19802518
MIRT006371 hsa-miR-181b-5p Luciferase reporter assay 21779448
MIRT006371 hsa-miR-181b-5p Luciferase reporter assay 21779448
MIRT006371 hsa-miR-181b-5p Luciferase reporter assay 21779448
MIRT006371 hsa-miR-181b-5p Luciferase reporter assay 21779448
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 19636380, 21282530
GO:0000785 Component Chromatin IDA 19636380
GO:0005515 Function Protein binding IPI 10369680, 17332741, 18927235, 19636380, 20543829, 20601937, 20696397, 21282530, 23523425, 24981860, 27705803, 28514442, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608457 1557 ENSG00000100307
Protein
UniProt ID O95931
Protein name Chromobox protein homolog 7
Protein function Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remod
PDB 2K1B , 2L12 , 2L1B , 3GS2 , 4MN3 , 5EPJ , 6V2R , 8SII
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00385 Chromo 11 60 Chromo (CHRromatin Organisation MOdifier) domain Domain
PF17218 CBX7_C 209 240 CBX family C-terminal motif Motif
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Sequence length 251
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Polycomb repressive complex  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple myeloma Multiple myeloma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 36221371
Adenocarcinoma of Lung Inhibit 36183965
Astrocytoma Associate 24260522
Brain Neoplasms Associate 34008756
Breast Neoplasms Associate 27102007, 33400401
Breast Neoplasms Inhibit 33082469
Carcinoma Embryonal Associate 19602592
Carcinoma Hepatocellular Associate 30481161, 31211140
Carcinoma Hepatocellular Inhibit 31211140
Carcinoma Intraductal Noninfiltrating Associate 21375733