SEC61G (SEC61 translocon subunit gamma)

Gene

• Entrez ID: 23480
• Gene name: SEC61 translocon subunit gamma
• Gene symbol: SEC61G
• Synonyms (NCBI Gene): SSS1
• Chromosome: 7
• Chromosome location: 7p11.2
• Summary: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER mem

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028829	hsa-miR-26b-5p	Microarray	19088304
MIRT052780	hsa-miR-1260b	CLASH	23622248
MIRT1333486	hsa-miR-1228	CLIP-seq
MIRT1333487	hsa-miR-197	CLIP-seq
MIRT1333488	hsa-miR-216b	CLIP-seq
MIRT1333489	hsa-miR-342-3p	CLIP-seq
MIRT1333490	hsa-miR-3675-3p	CLIP-seq
MIRT1333491	hsa-miR-3148	CLIP-seq
MIRT1333492	hsa-miR-4635	CLIP-seq
MIRT1333493	hsa-miR-488	CLIP-seq
MIRT1333494	hsa-miR-570	CLIP-seq
MIRT1333488	hsa-miR-216b	CLIP-seq
MIRT1333490	hsa-miR-3675-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32820719
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005784	Component	Sec61 translocon complex	IDA	31831667
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006605	Process	Protein targeting	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0008320	Function	Protein transmembrane transporter activity	IBA
GO:0008320	Function	Protein transmembrane transporter activity	IEA
GO:0008320	Function	Protein transmembrane transporter activity	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IDA	22375059
GO:0016020	Component	Membrane	IEA
GO:0031204	Process	Post-translational protein targeting to membrane, translocation	IBA
GO:0043022	Function	Ribosome binding	IDA	32820719
GO:0045047	Process	Protein targeting to ER	ISS
GO:0071261	Component	Ssh1 translocon complex	IBA

Other IDs

• MIM: 609215
• HGNC: 18277
• e!Ensembl: ENSG00000132432

Protein

• UniProt ID: P60059
• Protein name: Protein transport protein Sec61 subunit gamma
• Protein function: Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) (By similarity). Forms a ribosome receptor and a gated pore in the ER membran
• PDB: 6W6L, 8B6L, 8DNV, 8DNW, 8DNX, 8DNY, 8DNZ, 8DO0, 8DO1, 8DO2, 8DO3, 8OJ0, 8OJ8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00584	SecE	12 → 66	SecE/Sec61-gamma subunits of protein translocation complex	Family

• Sequence:

  MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
  INNIIVGG

• Sequence length: 68

Pathways

KEGG:

Protein export
Protein processing in endoplasmic reticulum
Phagosome
Vibrio cholerae infection

Reactome:

Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	34342091, 34774014, 37878007	★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Associate	24131581	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	33171060	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31841189	★☆☆☆☆ Found in Text Mining only
Fetal Alcohol Spectrum Disorders	Associate	37047575	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	31094363, 33171060, 34238116	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Stimulate	33846795	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	24871463	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	33171060, 33846795, 35955786, 37489460	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	34590792, 34774014	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Associate	34590792	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	34173014	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Stimulate	34590792	★☆☆☆☆ Found in Text Mining only