Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23468
Gene name Gene Name - the full gene name approved by the HGNC.
Chromobox 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CBX5
Synonyms (NCBI Gene) Gene synonyms aliases
HEL25, HP1, HP1A, HP1alpha
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HP1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004950 hsa-miR-98-5p qRT-PCR 17942906
MIRT023531 hsa-miR-1-3p Proteomics 18668040
MIRT052318 hsa-let-7b-5p CLASH 23622248
MIRT051655 hsa-let-7e-5p CLASH 23622248
MIRT049796 hsa-miR-92a-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
YY1 Unknown 19566924
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex ISS
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 19617346
GO:0000776 Component Kinetochore IEA
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000792 Component Heterochromatin TAS 8663349
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604478 1555 ENSG00000094916
Protein
UniProt ID P45973
Protein name Chromobox protein homolog 5 (Antigen p25) (Heterochromatin protein 1 homolog alpha) (HP1 alpha)
Protein function Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph) (PubMed:
PDB 3FDT , 3I3C , 8UXQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00385 Chromo 20 69 Chromo (CHRromatin Organisation MOdifier) domain Domain
PF01393 Chromo_shadow 122 174 Chromo shadow domain Domain
Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCP
ELISEFMKK
YKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG
LEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPED
AENKEKETAKS
Sequence length 191
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transcriptional Regulation by E2F6
Factors involved in megakaryocyte development and platelet production
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
25944804
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
25944804
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute Chest Syndrome Associate 36006620
Alternating hemiplegia of childhood Associate 19468068
Arterial Occlusive Diseases Associate 36006620
ATR X syndrome Associate 39862081
Brain Neoplasms Associate 28946550
Breast Neoplasms Associate 16051232, 21281799, 26791953, 27107417, 31253870, 33099470, 34087208
Breast Neoplasms Inhibit 16648629, 19566924
Calcinosis Cutis Inhibit 24840329
Carcinogenesis Associate 35249038
Carcinoma Renal Cell Associate 33185692, 35249038