Gene Gene information from NCBI Gene database.
Entrez ID 2346
Gene name Folate hydrolase 1
Gene symbol FOLH1
Synonyms (NCBI Gene)
FGCPFOLHGCP2GCPIINAALAD1PSMPSMAmGCP
Chromosome 11
Chromosome location 11p11.12
Summary This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-gl
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT029538 hsa-miR-26b-5p Microarray 19088304
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
AR Unknown 12539223
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004180 Function Carboxypeptidase activity IBA
GO:0004180 Function Carboxypeptidase activity IEA
GO:0004181 Function Metallocarboxypeptidase activity IDA 12949938, 17241121, 24863754
GO:0004181 Function Metallocarboxypeptidase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600934 3788 ENSG00000086205
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04609
Protein name Glutamate carboxypeptidase 2 (EC 3.4.17.21) (Cell growth-inhibiting gene 27 protein) (Folate hydrolase 1) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Glutamate carboxypeptidase II) (GCPII) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylate
Protein function Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotran
PDB 1Z8L , 2C6C , 2C6G , 2C6P , 2CIJ , 2JBJ , 2JBK , 2OOT , 2OR4 , 2PVV , 2PVW , 2XEF , 2XEG , 2XEI , 2XEJ , 3BHX , 3BI0 , 3BI1 , 3BXM , 3D7D , 3D7F , 3D7G , 3D7H , 3IWW , 3RBU , 3SJE , 3SJF , 3SJG , 3SJX , 4JYW , 4JZ0 , 4LQG , 4MCP , 4MCQ , 4MCR , 4MCS , 4NGM , 4NGN , 4NGP , 4NGQ , 4NGR , 4NGS , 4NGT , 4OC0 , 4OC1 , 4OC2 , 4OC3 , 4OC4 , 4OC5 , 4OME , 4P44
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02225 PA 170 261 PA domain Family
PF04389 Peptidase_M28 357 564 Peptidase family M28 Family
PF04253 TFR_dimer 627 747 Transferrin receptor-like dimerisation domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small i
Sequence
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNL
NGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG
TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE
LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN
WETNKFSGYPLYHSVYETYELVEK
FYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY
AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV
LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD
PSKAWGEVKRQIYVAAFTVQAAAETLS
EVA
Sequence length 750
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Alanine, aspartate and glutamate metabolism
Metabolic pathways
Vitamin digestion and absorption
Folate transport and metabolism
  Aspartate and asparagine metabolism
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cholangiocarcinoma Benign rs79155991 RCV005893635
Colorectal cancer Benign rs79155991 RCV005893634
Nonpapillary renal cell carcinoma Uncertain significance rs753879892 RCV005932275
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Stimulate 38629815
Acute Kidney Injury Associate 34272322
Adenocarcinoma Associate 15713827, 18802790, 21640619, 21731703, 32808077, 37381796, 38302933, 39236400
Adenocarcinoma Stimulate 32703222
Adenocarcinoma Follicular Associate 28701709
Adenomatous Polyps Associate 26028103
Anemia Associate 34272322, 38452035
Astrocytoma Associate 37247303
Bankart Lesions Associate 30901173
Bipolar Disorder Stimulate 18191545