Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23456
Gene name Gene Name - the full gene name approved by the HGNC.
ATP binding cassette subfamily B member 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ABCB10
Synonyms (NCBI Gene) Gene synonyms aliases
EST20237, M-ABC2, MTABC2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.13
Summary Summary of gene provided in NCBI Entrez Gene.
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024476 hsa-miR-215-5p Microarray 19074876
MIRT026891 hsa-miR-192-5p Microarray 19074876
MIRT028616 hsa-miR-30a-5p Proteomics 18668040
MIRT030557 hsa-miR-24-3p Microarray 19748357
MIRT032488 hsa-let-7b-5p Proteomics 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25063848
GO:0005524 Function ATP binding IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0006839 Process Mitochondrial transport NAS 10922475
GO:0016887 Function ATPase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605454 41 ENSG00000135776
Protein
UniProt ID Q9NRK6
Protein name ATP-binding cassette sub-family B member 10, mitochondrial (ABC-mitochondrial erythroid protein) (ABC-me protein) (ATP-binding cassette transporter 10) (ABC transporter 10 protein) (EC 7.6.2.-) (Mitochondrial ATP-binding cassette 2) (M-ABC2)
Protein function ATP-dependent transporter located in the mitochondrial inner membrane that catalyzes the export of biliverdin from the mitochondrial matrix, and plays a crucial role in hemoglobin synthesis and antioxidative stress (PubMed:22085049, PubMed:28315
PDB 3ZDQ , 4AYT , 4AYW , 4AYX , 7Y48 , 7Y49
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00664 ABC_membrane 171 442 ABC transporter transmembrane region Family
PF00005 ABC_tran 510 662 ABC transporter Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymp
Sequence
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLW
GVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPG
GPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTM
SSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSG
QRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
SVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGN
VRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVG
ISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEG
VILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLL
LRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTA
EEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEA
TS
ALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLS
KPNGIYRKLMNKQSFISA
Sequence length 738
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ABC transporters   Mitochondrial ABC transporters
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
22294766
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
22294766
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
30054458, 30595370
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 31931771
Carcinoma Ovarian Epithelial Associate 31381507, 33760208
Carcinoma Renal Cell Associate 31106654, 31931771
Chronic Disease Associate 35218958
Esophageal Squamous Cell Carcinoma Associate 32572924
Glioma Associate 32633377
Laryngeal Neoplasms Associate 35756421
Lung Neoplasms Associate 31556152, 31931771, 32572881
Lymphatic Metastasis Associate 31106654
Nasopharyngeal Carcinoma Associate 33336739