CELA3B (chymotrypsin like elastase 3B)

Gene

• Entrez ID: 23436
• Gene name: Chymotrypsin like elastase 3B
• Gene symbol: CELA3B
• Synonyms (NCBI Gene): CBPP, ELA3B
• Chromosome: 1
• Chromosome location: 1p36.12
• Summary: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3B has li

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019053	hsa-miR-335-5p	Microarray	18185580
MIRT030228	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	2737288
GO:0004252	Function	Serine-type endopeptidase activity	TAS	2826474
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2460440
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	TAS	2460440
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 618694
• HGNC: 15945
• e!Ensembl: ENSG00000219073

Protein

• UniProt ID: P08861
• Protein name: Chymotrypsin-like elastase family member 3B (EC 3.4.21.70) (Elastase IIIB) (Elastase-3B) (Protease E)
• Protein function: Efficient protease with alanine specificity but only little elastolytic activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	29 → 263	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Pancreas. Not detectable in keratinocytes. {ECO:0000269|PubMed:10620133}.
• Sequence:

  MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
  SLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVAC
  GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALL
  PVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
  AFGCNTRRKPTVFTRVSAFIDWIEETIASH

• Sequence length: 270

Pathways

KEGG:

Pancreatic secretion
Protein digestion and absorption

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Acinar Cell	Associate	37379306	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	31917448, 37379306	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Associate	27999401, 35773178	★☆☆☆☆ Found in Text Mining only