Gene Gene information from NCBI Gene database.
Entrez ID 23432
Gene name G protein-coupled receptor 161
Gene symbol GPR161
Synonyms (NCBI Gene)
RE2
Chromosome 1
Chromosome location 1q24.2
Summary The protein encoded by this gene is an orphan G protein-coupled receptor whose ligand is unknown. This gene is overexpressed in triple-negative breast cancer, and disruption of this gene slows the proliferation of basal breast cancer cells. Therefore, thi
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs200635937 A>T Uncertain-significance, likely-pathogenic Missense variant, intron variant, coding sequence variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
51
miRTarBase ID miRNA Experiments Reference
MIRT022199 hsa-miR-124-3p Microarray 18668037
MIRT1030851 hsa-miR-101 CLIP-seq
MIRT1030852 hsa-miR-1183 CLIP-seq
MIRT1030853 hsa-miR-1269 CLIP-seq
MIRT1030854 hsa-miR-1269b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612250 23694 ENSG00000143147
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N6U8
Protein name G-protein coupled receptor 161 (G-protein coupled receptor RE2)
Protein function Key negative regulator of Shh signaling, which promotes the processing of GLI3 into GLI3R during neural tube development. Recruited by TULP3 and the IFT-A complex to primary cilia and acts as a regulator of the PKA-dependent basal repression mac
PDB 8KH4 , 8SMV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 44 324 7 transmembrane receptor (rhodopsin family) Family
Sequence
MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLT
LSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGV
IAIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVA
AWHREPGYTAFWQIWCALFPFLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRK
NSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFMVTWGPYMVVIASEALWGKSS
VSPSLETWATWLSFASAVCHPLIY
GLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFS
ISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSH
CTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFG
EEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLAAEQR
Sequence length 529
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hedgehog signaling pathway   Hedgehog 'off' state
Hedgehog 'on' state
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
19
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Medulloblastoma Pathogenic rs147891461 RCV002291250
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial pancreatic carcinoma Benign rs73030230 RCV005920604
GPR161-related disorder Likely benign rs147976800 RCV003972300
Nonpapillary renal cell carcinoma Benign rs73030230 RCV005920602
Ovarian cancer Benign rs73030230 RCV005920603
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Basal Cell Nevus Syndrome Associate 36961676
Breast Neoplasms Associate 24599592, 8662988
Huntington Disease Associate 32898862
Medulloblastoma Associate 31609649, 32056145, 36961676
Neoplasms Associate 31609649
Pneumonia Associate 37327587
Triple Negative Breast Neoplasms Stimulate 24599592