Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23432
Gene name Gene Name - the full gene name approved by the HGNC.
G protein-coupled receptor 161
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPR161
Synonyms (NCBI Gene) Gene synonyms aliases
RE2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an orphan G protein-coupled receptor whose ligand is unknown. This gene is overexpressed in triple-negative breast cancer, and disruption of this gene slows the proliferation of basal breast cancer cells. Therefore, thi
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs200635937 A>T Uncertain-significance, likely-pathogenic Missense variant, intron variant, coding sequence variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022199 hsa-miR-124-3p Microarray 18668037
MIRT1030851 hsa-miR-101 CLIP-seq
MIRT1030852 hsa-miR-1183 CLIP-seq
MIRT1030853 hsa-miR-1269 CLIP-seq
MIRT1030854 hsa-miR-1269b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IBA 21873635
GO:0004930 Function G protein-coupled receptor activity ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005929 Component Cilium ISS
GO:0007186 Process G protein-coupled receptor signaling pathway IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612250 23694 ENSG00000143147
Protein
UniProt ID Q8N6U8
Protein name G-protein coupled receptor 161 (G-protein coupled receptor RE2)
Protein function Key negative regulator of Shh signaling, which promotes the processing of GLI3 into GLI3R during neural tube development. Recruited by TULP3 and the IFT-A complex to primary cilia and acts as a regulator of the PKA-dependent basal repression mac
PDB 8KH4 , 8SMV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 44 324 7 transmembrane receptor (rhodopsin family) Family
Sequence
MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLT
LSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGV
IAIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVA
AWHREPGYTAFWQIWCALFPFLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRK
NSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFMVTWGPYMVVIASEALWGKSS
VSPSLETWATWLSFASAVCHPLIY
GLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFS
ISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSH
CTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFG
EEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLAAEQR
Sequence length 529
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hedgehog signaling pathway   Hedgehog 'off' state
Hedgehog 'on' state
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29059683
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Diabetes insipidus Diabetes Insipidus rs781942628, rs104894747, rs104894748, rs104894749, rs104894750, rs28935496, rs2147483647, rs104894751, rs104894752, rs104894753, rs104894754, rs104894755, rs1569545523, rs104894756, rs104894757
View all (33 more)
Unknown
Disease term Disease name Evidence References Source
Pituitary stalk interruption syndrome Pituitary stalk interruption syndrome 25322266 ClinVar
Pituitary Stalk Interruption Syndrome pituitary stalk interruption syndrome GenCC
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Basal Cell Nevus Syndrome Associate 36961676
Breast Neoplasms Associate 24599592, 8662988
Huntington Disease Associate 32898862
Medulloblastoma Associate 31609649, 32056145, 36961676
Neoplasms Associate 31609649
Pneumonia Associate 37327587
Triple Negative Breast Neoplasms Stimulate 24599592