Gene Gene information from NCBI Gene database.
Entrez ID 23429
Gene name RING1 and YY1 binding protein
Gene symbol RYBP
Synonyms (NCBI Gene)
AAP1APAP-1DEDAFYEAF1
Chromosome 3
Chromosome location 3p13
miRNA miRNA information provided by mirtarbase database.
1142
miRTarBase ID miRNA Experiments Reference
MIRT027957 hsa-miR-93-5p Sequencing 20371350
MIRT046103 hsa-miR-125b-5p CLASH 23622248
MIRT053368 hsa-miR-9-5p MicroarrayqRT-PCR 23798388
MIRT708773 hsa-miR-548a-5p HITS-CLIP 19536157
MIRT708772 hsa-miR-548ab HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0003676 Function Nucleic acid binding EXP 19170609, 20696397
GO:0003677 Function DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0003712 Function Transcription coregulator activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607535 10480 ENSG00000163602
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N488
Protein name RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)
Protein function Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin
PDB 3IXS , 8PP6 , 9DBY , 9DDE , 9DG3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00641 zf-RanBP 22 48 Zn-finger in Ran binding protein and others Domain
PF17219 YAF2_RYBP 145 177 Yaf2/RYBP C-terminal binding motif Motif
Tissue specificity TISSUE SPECIFICITY: Down-regulated in breast cancer tissues and in several breast cancer cell lines (at protein level) (PubMed:27748911). Widely expressed with highest levels in lymphoid tissues and placenta. {ECO:0000269|PubMed:11395500, ECO:0000269|PubM
Sequence
MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQ
LVAQQVAQQYATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKD
PPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSS
STSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
Sequence length 228
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex   RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
Transcriptional Regulation by E2F6
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Allergic Fungal Sinusitis Associate 22723975
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Associate 33875655
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 26319120
★☆☆☆☆
Found in Text Mining only
Carcinoma Ductal Breast Associate 26319120
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 28028181
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 37654197
★☆☆☆☆
Found in Text Mining only
Glioblastoma Associate 24260522
★☆☆☆☆
Found in Text Mining only
Hodgkin Disease Associate 16528373, 21393330
★☆☆☆☆
Found in Text Mining only
Inflammation Associate 22723975
★☆☆☆☆
Found in Text Mining only
Melanoma Associate 26104682
★☆☆☆☆
Found in Text Mining only