Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23421
Gene name Gene Name - the full gene name approved by the HGNC.	Integrin subunit beta 3 binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ITGB3BP
Synonyms (NCBI Gene) Gene synonyms aliases	CENP-R, CENPR, HSU37139, NRIF3, TAP20
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p31.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signali

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045781	hsa-miR-9-5p	CLASH	23622248
MIRT528580	hsa-miR-3156-5p	PAR-CLIP	22012620
MIRT528579	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT528578	hsa-miR-7161-3p	PAR-CLIP	22012620
MIRT528577	hsa-miR-4491	PAR-CLIP	22012620
MIRT528576	hsa-miR-4657	PAR-CLIP	22012620
MIRT528575	hsa-miR-299-3p	PAR-CLIP	22012620
MIRT528574	hsa-miR-4536-5p	PAR-CLIP	22012620
MIRT528573	hsa-miR-150-3p	PAR-CLIP	22012620
MIRT528580	hsa-miR-3156-5p	PAR-CLIP	22012620
MIRT528579	hsa-miR-224-5p	PAR-CLIP	22012620
MIRT528578	hsa-miR-7161-3p	PAR-CLIP	22012620
MIRT528577	hsa-miR-4491	PAR-CLIP	22012620
MIRT528576	hsa-miR-4657	PAR-CLIP	22012620
MIRT528575	hsa-miR-299-3p	PAR-CLIP	22012620
MIRT528574	hsa-miR-4536-5p	PAR-CLIP	22012620
MIRT528573	hsa-miR-150-3p	PAR-CLIP	22012620

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MTA1	Unknown	15254226

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000939	Component	Inner kinetochore	IPI	36085283
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 26496610, 31515488, 32296183, 32814053, 33961781
GO:0005515	Function	Protein binding	TAS	10490654
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	36085283
GO:0005634	Component	Nucleus	TAS	10490654
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7593198
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007059	Process	Chromosome segregation	NAS	36085283
GO:0007155	Process	Cell adhesion	TAS	7593198
GO:0007165	Process	Signal transduction	TAS	7593198, 10490654
GO:0016020	Component	Membrane	TAS	7593198
GO:0034080	Process	CENP-A containing chromatin assembly	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051301	Process	Cell division	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA

MIM	HGNC	e!Ensembl
605494	6157	ENSG00000142856

Protein

UniProt ID

Q13352

Protein name

Centromere protein R (CENP-R) (Beta-3-endonexin) (Integrin beta-3-binding protein) (Nuclear receptor-interacting factor 3)

Protein function

Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fas

PDB

7PB8 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06729	CENP-R	25 → 162	Kinetochore component, CENP-R	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in spleen, thymus, prostate, ovary, small intestine and white blood cells. Highly expressed in testis and colon. Isoform 4 is expressed in platelets, lymphocytes and granulocytes. {ECO:0000269|PubMed:1186470

Sequence

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLS
NEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELE
NLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

Sequence length

177

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal NRIF signals cell death from the nucleus Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Deposition of new CENPA-containing nucleosomes at the centromere Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

ITGB3BP (integrin subunit beta 3 binding protein)