SIRT1 (sirtuin 1)

Gene

• Entrez ID: 23411
• Gene name: Sirtuin 1
• Gene symbol: SIRT1
• Synonyms (NCBI Gene): SIR2, SIR2L1, SIR2alpha
• Chromosome: 10
• Chromosome location: 10q21.3
• Summary: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002098	hsa-miR-34a-5p	Western blot	18834855
MIRT002098	hsa-miR-34a-5p	Western blot, Luciferase reporter assay, Northern blot	18755897
MIRT002098	hsa-miR-34a-5p	Western blot, Luciferase reporter assay, Northern blot	18755897
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18834855
MIRT002098	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	18834855
MIRT002098	hsa-miR-34a-5p	Review	19815577
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20185821
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot	19786632
MIRT005018	hsa-miR-216a-5p	Luciferase reporter assay, Western blot	19786632
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20627091
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20627091
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	19221490
MIRT000333	hsa-miR-132-3p	Luciferase reporter assay, Western blot	19819989
MIRT002098	hsa-miR-34a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	20470934
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006878	hsa-miR-181c-5p	In situ hybridization, Luciferase reporter assay	21720722
MIRT006892	hsa-miR-9-5p	In situ hybridization, Luciferase reporter assay	21720722
MIRT007324	hsa-miR-128-3p	Luciferase reporter assay	23492773
MIRT006892	hsa-miR-9-5p	Western blot;qRT-PCR	20362537
MIRT023069	hsa-miR-124-3p	qRT-PCR	20362537
MIRT024509	hsa-miR-215-5p	Microarray	19074876
MIRT002098	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR	20185821
MIRT002098	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR	20627091
MIRT026849	hsa-miR-192-5p	Microarray	19074876
MIRT052646	hsa-miR-199a-5p	qRT-PCR, Western blot	23760629
MIRT051790	hsa-let-7c-5p	CLASH	23622248
MIRT043458	hsa-miR-331-3p	CLASH	23622248
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23768087
MIRT053343	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23728341
MIRT053343	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23728341
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23768087
MIRT052646	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24839982
MIRT002098	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23954321
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT002098	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT002098	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23954321
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT002098	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT177771	hsa-miR-548at-5p	PAR-CLIP	22100165
MIRT450611	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT439628	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439628	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT002098	hsa-miR-34a-5p	Western blot	25348795
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	25526086
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	25526086
MIRT002098	hsa-miR-34a-5p	Western blot	25585539
MIRT052646	hsa-miR-199a-5p	Luciferase reporter assay	26344589
MIRT002098	hsa-miR-34a-5p	5.0	26802970
MIRT002098	hsa-miR-34a-5p	5.0	26802970
MIRT006271	hsa-miR-138-5p	In situ hybridization, Luciferase reporter assay, Western blot	28052003
MIRT006271	hsa-miR-138-5p	In situ hybridization, Luciferase reporter assay, Western blot	28052003
MIRT006213	hsa-miR-181a-5p	GFP reporter assay	26922183
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27166997
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27166997
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay	27156885
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27090017
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27090017
MIRT263012	hsa-miR-543	Luciferase reporter assay, qRT-PCR, Western blot	26612257
MIRT263012	hsa-miR-543	Luciferase reporter assay, qRT-PCR, Western blot	26612257
MIRT052646	hsa-miR-199a-5p	Immunoprecipitaion, qRT-PCR, Western blot	26945677
MIRT006348	hsa-miR-449a	Immunoblot, Luciferase reporter assay, qRT-PCR	26988912
MIRT006348	hsa-miR-449a	Immunoblot, Luciferase reporter assay, qRT-PCR	26988912
MIRT006348	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	27421775
MIRT006348	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	27421775
MIRT733820	hsa-miR-34a-3p	Western blot	25395581
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT002098	hsa-miR-34a-5p	Immunoblot, qRT-PCR	28250026
MIRT000333	hsa-miR-132-3p	ChIP-seq, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	28383763
MIRT000333	hsa-miR-132-3p	ChIP-seq, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	28383763
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28236278
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, Western blot	28236278
MIRT002098	hsa-miR-34a-5p	Western blot	25826085
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25998694
MIRT023069	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27748572
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27748572
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756894
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756894
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	28236278
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27247228
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	26662303
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blotting, qRT-PCR	32267139
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31432137
MIRT733631	hsa-miR-1301-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33987098
MIRT733820	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT733852	hsa-miR-92a-3p	qRT-PCR, Western blotting	33742265
MIRT052646	hsa-miR-199a-5p	ELISA, Immunofluorescence, Luciferase reporter assay, qRT-PCR, RNA-seq, Western blotting	34132029
MIRT263019	hsa-miR-22-3p	Western blotting, Microarray, qRT-PCR	31612074
MIRT734467	hsa-miR-155-3p	Immunofluorescence, Luciferase reporter assay, Western blotting	33748285
MIRT002098	hsa-miR-34a-5p	Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	32161722
MIRT002098	hsa-miR-34a-5p	qRT-PCR	31885789
MIRT735066	hsa-miR-27a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, Flow cytometry	32790210
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33488795
MIRT000333	hsa-miR-132-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32950974
MIRT735186	hsa-miR-212-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32950974
MIRT000333	hsa-miR-132-3p	Western blotting, qRT-PCR, ELISA	32219698
MIRT735713	hsa-miR-1185-1-3p	Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), in vitro cullelar assays, qRT-PCR, Flow cytometry	33046442
MIRT007324	hsa-miR-128-3p	Western blotting, qRT-PCR	32528236
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31503007
MIRT731643	hsa-miR-133b	qRT-PCR	32655835
MIRT737526	hsa-miR-29a-3p	Microarray, qRT-PCR	32741895
MIRT737527	hsa-miR-23a-3p	Microarray, qRT-PCR	32741895
MIRT177771	hsa-miR-548at-5p	PAR-CLIP	22100165
MIRT450611	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	38828289
MIRT756377	hsa-miR-139-5p	Western blotting	37794118
MIRT756394	hsa-miR-141-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34868528
MIRT1350042	hsa-miR-3125	CLIP-seq
MIRT1350043	hsa-miR-3916	CLIP-seq
MIRT1350044	hsa-miR-4266	CLIP-seq
MIRT1350045	hsa-miR-4477a	CLIP-seq
MIRT1350046	hsa-miR-4765	CLIP-seq
MIRT1350047	hsa-miR-4775	CLIP-seq
MIRT1350048	hsa-miR-502-5p	CLIP-seq
MIRT1350049	hsa-miR-651	CLIP-seq
MIRT1350050	hsa-miR-1208	CLIP-seq
MIRT1350051	hsa-miR-1271	CLIP-seq
MIRT1350052	hsa-miR-1279	CLIP-seq
MIRT1350053	hsa-miR-1283	CLIP-seq
MIRT1350054	hsa-miR-1301	CLIP-seq
MIRT1350055	hsa-miR-132	CLIP-seq
MIRT1350056	hsa-miR-182	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350058	hsa-miR-200b	CLIP-seq
MIRT1350059	hsa-miR-200c	CLIP-seq
MIRT1350060	hsa-miR-212	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT1350062	hsa-miR-2355-5p	CLIP-seq
MIRT1350063	hsa-miR-23a	CLIP-seq
MIRT1350064	hsa-miR-23b	CLIP-seq
MIRT1350065	hsa-miR-23c	CLIP-seq
MIRT1350066	hsa-miR-29a	CLIP-seq
MIRT1350067	hsa-miR-29b	CLIP-seq
MIRT1350068	hsa-miR-29c	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350071	hsa-miR-3140-3p	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT1350073	hsa-miR-3163	CLIP-seq
MIRT1350074	hsa-miR-3177-5p	CLIP-seq
MIRT1350075	hsa-miR-3190	CLIP-seq
MIRT1350076	hsa-miR-338-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350079	hsa-miR-3591-5p	CLIP-seq
MIRT1350080	hsa-miR-3607-3p	CLIP-seq
MIRT1350081	hsa-miR-3618	CLIP-seq
MIRT1350082	hsa-miR-374c	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350084	hsa-miR-412	CLIP-seq
MIRT1350085	hsa-miR-4251	CLIP-seq
MIRT1350086	hsa-miR-4280	CLIP-seq
MIRT1350087	hsa-miR-4286	CLIP-seq
MIRT1350088	hsa-miR-429	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT1350090	hsa-miR-4418	CLIP-seq
MIRT1350091	hsa-miR-4420	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350093	hsa-miR-448	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT1350095	hsa-miR-450b-5p	CLIP-seq
MIRT1350096	hsa-miR-4635	CLIP-seq
MIRT1350097	hsa-miR-4660	CLIP-seq
MIRT1350098	hsa-miR-4662a-5p	CLIP-seq
MIRT1350099	hsa-miR-4695-3p	CLIP-seq
MIRT1350100	hsa-miR-4752	CLIP-seq
MIRT1350101	hsa-miR-4773	CLIP-seq
MIRT1350102	hsa-miR-4795-3p	CLIP-seq
MIRT1350103	hsa-miR-488	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT1350105	hsa-miR-5047	CLIP-seq
MIRT1350106	hsa-miR-507	CLIP-seq
MIRT1350107	hsa-miR-509-3-5p	CLIP-seq
MIRT1350108	hsa-miR-509-5p	CLIP-seq
MIRT1350109	hsa-miR-526b	CLIP-seq
MIRT1350110	hsa-miR-539	CLIP-seq
MIRT1350111	hsa-miR-548a-5p	CLIP-seq
MIRT1350112	hsa-miR-548ab	CLIP-seq
MIRT1350113	hsa-miR-548ak	CLIP-seq
MIRT1350114	hsa-miR-548b-5p	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT1350116	hsa-miR-548c-5p	CLIP-seq
MIRT1350117	hsa-miR-548d-5p	CLIP-seq
MIRT1350118	hsa-miR-548h	CLIP-seq
MIRT1350119	hsa-miR-548i	CLIP-seq
MIRT1350120	hsa-miR-548j	CLIP-seq
MIRT1350121	hsa-miR-548k	CLIP-seq
MIRT1350122	hsa-miR-548l	CLIP-seq
MIRT1350123	hsa-miR-548n	CLIP-seq
MIRT1350124	hsa-miR-548t	CLIP-seq
MIRT1350125	hsa-miR-548u	CLIP-seq
MIRT1350126	hsa-miR-548w	CLIP-seq
MIRT1350127	hsa-miR-548y	CLIP-seq
MIRT1350128	hsa-miR-557	CLIP-seq
MIRT1350129	hsa-miR-559	CLIP-seq
MIRT1350130	hsa-miR-570	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350132	hsa-miR-590-3p	CLIP-seq
MIRT1350133	hsa-miR-607	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT1350135	hsa-miR-633	CLIP-seq
MIRT1350136	hsa-miR-655	CLIP-seq
MIRT1350137	hsa-miR-936	CLIP-seq
MIRT1350138	hsa-miR-96	CLIP-seq
MIRT1350053	hsa-miR-1283	CLIP-seq
MIRT1350055	hsa-miR-132	CLIP-seq
MIRT2103736	hsa-miR-141	CLIP-seq
MIRT2103737	hsa-miR-200a	CLIP-seq
MIRT1350060	hsa-miR-212	CLIP-seq
MIRT2103738	hsa-miR-3143	CLIP-seq
MIRT2103739	hsa-miR-3149	CLIP-seq
MIRT1350076	hsa-miR-338-5p	CLIP-seq
MIRT1350081	hsa-miR-3618	CLIP-seq
MIRT1350047	hsa-miR-4775	CLIP-seq
MIRT1350133	hsa-miR-607	CLIP-seq
MIRT2327874	hsa-miR-4699-5p	CLIP-seq
MIRT2327875	hsa-miR-4709-3p	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT2622859	hsa-miR-221	CLIP-seq
MIRT2622860	hsa-miR-222	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT2622861	hsa-miR-3128	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT2622862	hsa-miR-3152-3p	CLIP-seq
MIRT2622863	hsa-miR-3187-3p	CLIP-seq
MIRT2622864	hsa-miR-326	CLIP-seq
MIRT2622865	hsa-miR-330-3p	CLIP-seq
MIRT2622866	hsa-miR-330-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT2622867	hsa-miR-4422	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT2622868	hsa-miR-4529-5p	CLIP-seq
MIRT2622869	hsa-miR-4666-5p	CLIP-seq
MIRT2622870	hsa-miR-4720-5p	CLIP-seq
MIRT2622871	hsa-miR-4729	CLIP-seq
MIRT2622872	hsa-miR-4768-5p	CLIP-seq
MIRT1350101	hsa-miR-4773	CLIP-seq
MIRT2622873	hsa-miR-4799-3p	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT2622874	hsa-miR-494	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT2622875	hsa-miR-548v	CLIP-seq
MIRT2622876	hsa-miR-556-5p	CLIP-seq
MIRT2622877	hsa-miR-562	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT2622878	hsa-miR-616	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT2622861	hsa-miR-3128	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT2622862	hsa-miR-3152-3p	CLIP-seq
MIRT2622863	hsa-miR-3187-3p	CLIP-seq
MIRT2622864	hsa-miR-326	CLIP-seq
MIRT2622866	hsa-miR-330-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT2622868	hsa-miR-4529-5p	CLIP-seq
MIRT2622870	hsa-miR-4720-5p	CLIP-seq
MIRT2622872	hsa-miR-4768-5p	CLIP-seq
MIRT2622873	hsa-miR-4799-3p	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT2622877	hsa-miR-562	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT2622878	hsa-miR-616	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	22363646
ATF4	Repression	21801305
BRCA1	Activation	18851829;20160719;21407215;9000507
CIITA	Repression	22064865
DDIT3	Repression	21801305
FOXL2	Activation	19010791
FOXO3	Activation	23525956
GTF2I	Activation	21407215
HIC1	Repression	19525223;19649206
HIC1	Unknown	22064865
RELA	Activation	20617556
SP1	Unknown	23843607

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000012	Process	Single strand break repair	IMP	20097625
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12535671, 15692560, 20955178
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21947282
GO:0000183	Process	RDNA heterochromatin assembly	IDA	18485871
GO:0000183	Process	RDNA heterochromatin assembly	TAS
GO:0000720	Process	Pyrimidine dimer repair by nucleotide-excision repair	IMP	21149730
GO:0000731	Process	DNA synthesis involved in DNA repair	ISS
GO:0000785	Component	Chromatin	IDA	17505061, 22956909
GO:0000791	Component	Euchromatin	IDA	15469825
GO:0000792	Component	Heterochromatin	IDA	15469825
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001525	Process	Angiogenesis	IDA	20620956
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0001678	Process	Cellular glucose homeostasis	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	20203304
GO:0002039	Function	P53 binding	IBA	21873635
GO:0002039	Function	P53 binding	IPI	11672523
GO:0002821	Process	Positive regulation of adaptive immune response	IDA	21890893
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IDA	12535671
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0003950	Function	NAD+ ADP-ribosyltransferase activity	TAS	17456799
GO:0004407	Function	Histone deacetylase activity	EXP	18485871
GO:0004407	Function	Histone deacetylase activity	IDA	20027304
GO:0005515	Function	Protein binding	IPI	11672523, 12006491, 12535671, 14976264, 15126506, 15152190, 15175761, 15205477, 15220471, 15632193, 15692560, 16892051, 16998810, 17172643, 17334224, 17612497, 17680780, 17901049, 17936707, 17964266, 18004385, 18203716, 18235501, 18235502, 18296641, 18485871, 19047049, 19188449, 192
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11672523, 19934257, 20027304, 20167603, 20955178
GO:0005635	Component	Nuclear envelope	IDA	15469825
GO:0005637	Component	Nuclear inner membrane	IBA	21873635
GO:0005637	Component	Nuclear inner membrane	IDA	15469825
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005677	Component	Chromatin silencing complex	IDA	18485871
GO:0005730	Component	Nucleolus	IDA	15469825
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005737	Component	Cytoplasm	IDA	20027304
GO:0005737	Component	Cytoplasm	IDA	15469825
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IMP	22956909
GO:0006346	Process	DNA methylation-dependent heterochromatin assembly	TAS	21947282
GO:0006471	Process	Protein ADP-ribosylation	TAS	17456799
GO:0006476	Process	Protein deacetylation	IDA	18203716, 18662546, 20027304, 20955178, 31722219
GO:0006476	Process	Protein deacetylation	IMP	11672523, 20424141, 24824780
GO:0006476	Process	Protein deacetylation	TAS	28386764
GO:0006642	Process	Triglyceride mobilization	ISS
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	18203716
GO:0006979	Process	Response to oxidative stress	IDA	14976264
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	23960241
GO:0007283	Process	Spermatogenesis	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	15692560
GO:0007517	Process	Muscle organ development	IEA
GO:0007569	Process	Cell aging	TAS	11672523
GO:0008022	Function	Protein C-terminus binding	IPI	18203716
GO:0008134	Function	Transcription factor binding	IPI	20955178, 23382074
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21807113
GO:0009267	Process	Cellular response to starvation	ISS
GO:0010629	Process	Negative regulation of gene expression	IMP	17916362, 20203304
GO:0010824	Process	Regulation of centrosome duplication	IDA	31722219
GO:0010875	Process	Positive regulation of cholesterol efflux	ISS
GO:0010883	Process	Regulation of lipid storage	ISS
GO:0010906	Process	Regulation of glucose metabolic process	ISS
GO:0010934	Process	Macrophage cytokine production	ISS
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0016032	Process	Viral process	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IDA	18296641
GO:0016567	Process	Protein ubiquitination	IDA	21841822
GO:0016567	Process	Protein ubiquitination	IMP	20203304
GO:0016575	Process	Histone deacetylation	IDA	12006491, 15469825, 16079181, 17172643
GO:0016605	Component	PML body	IDA	12006491
GO:0017136	Function	NAD-dependent histone deacetylase activity	IBA	21873635
GO:0017136	Function	NAD-dependent histone deacetylase activity	IDA	12006491, 15469825, 16959573
GO:0018394	Process	Peptidyl-lysine acetylation	IMP	18004385
GO:0019213	Function	Deacetylase activity	IDA	18203716
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030225	Process	Macrophage differentiation	ISS
GO:0030308	Process	Negative regulation of cell growth	IMP	17505061
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0031393	Process	Negative regulation of prostaglandin biosynthetic process	ISS
GO:0031507	Process	Heterochromatin assembly	IDA	15469825
GO:0031648	Process	Protein destabilization	IDA	20955178
GO:0031648	Process	Protein destabilization	ISS
GO:0032007	Process	Negative regulation of TOR signaling	IMP	20169165
GO:0032071	Process	Regulation of endodeoxyribonuclease activity	IMP	19934257
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	15152190
GO:0032868	Process	Response to insulin	ISS
GO:0032922	Process	Circadian regulation of gene expression	IMP	18662546
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033210	Process	Leptin-mediated signaling pathway	ISS
GO:0033553	Component	RDNA heterochromatin	IBA	21873635
GO:0033553	Component	RDNA heterochromatin	IDA	18485871
GO:0033558	Function	Protein deacetylase activity	IDA	19934257, 20027304, 21807113, 23056314
GO:0033558	Function	Protein deacetylase activity	IMP	20424141, 20670893
GO:0034391	Process	Regulation of smooth muscle cell apoptotic process	ISS
GO:0034979	Function	NAD-dependent protein deacetylase activity	IDA	20955178, 21775285
GO:0034979	Function	NAD-dependent protein deacetylase activity	IMP	11672523
GO:0034979	Function	NAD-dependent protein deacetylase activity	TAS
GO:0034983	Process	Peptidyl-lysine deacetylation	IDA	15469825
GO:0035098	Component	ESC/E(Z) complex	IDA	15684044
GO:0035257	Function	Nuclear hormone receptor binding	IPI	24043310
GO:0035356	Process	Cellular triglyceride homeostasis	ISS
GO:0035358	Process	Regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0042127	Process	Regulation of cell population proliferation	IMP	12006491
GO:0042326	Process	Negative regulation of phosphorylation	IMP	17612497
GO:0042393	Function	Histone binding	IPI	15469825, 22956909
GO:0042542	Process	Response to hydrogen peroxide	IDA	19934257
GO:0042595	Process	Behavioral response to starvation	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	20100829
GO:0042802	Function	Identical protein binding	IPI	15469825
GO:0042981	Process	Regulation of apoptotic process	IMP	19934257
GO:0043065	Process	Positive regulation of apoptotic process	IDA	15152190
GO:0043065	Process	Positive regulation of apoptotic process	IMP	19047049
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16892051, 21775285
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17680780
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21841822
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	19047049
GO:0043398	Function	HLH domain binding	IPI	12535671
GO:0043425	Function	BHLH transcription factor binding	IPI	12535671, 21807113
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	11672523, 20955178
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	17505061
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	11672523
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	23960241
GO:0044321	Process	Response to leptin	ISS
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IDA	21890893
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	30193097
GO:0045739	Process	Positive regulation of DNA repair	IMP	19934257
GO:0045766	Process	Positive regulation of angiogenesis	IDA	23960241, 25217442
GO:0045766	Process	Positive regulation of angiogenesis	IMP	20424141, 24048733
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	11672523, 20074560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12837246, 21807113
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	21241768
GO:0046872	Function	Metal ion binding	IEA
GO:0046969	Function	NAD-dependent histone deacetylase activity (H3-K9 specific)	ISS
GO:0050872	Process	White fat cell differentiation	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	20027304
GO:0051097	Process	Negative regulation of helicase activity	IDA	18203716
GO:0051152	Process	Positive regulation of smooth muscle cell differentiation	IEA
GO:0051574	Process	Positive regulation of histone H3-K9 methylation	IMP	22956909
GO:0051898	Process	Negative regulation of protein kinase B signaling	IMP	21149730
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	17505061
GO:0061647	Process	Histone H3-K9 modification	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	20027304
GO:0070403	Function	NAD+ binding	IBA	21873635
GO:0070829	Process	Heterochromatin maintenance	IMP	15469825
GO:0070857	Process	Regulation of bile acid biosynthetic process	ISS
GO:0070914	Process	UV-damage excision repair	IMP	20670893
GO:0070932	Process	Histone H3 deacetylation	IBA	21873635
GO:0070932	Process	Histone H3 deacetylation	IDA	20027304
GO:0070932	Process	Histone H3 deacetylation	IMP	17505061
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	15152190
GO:0071441	Process	Negative regulation of histone H3-K14 acetylation	IMP	17916362
GO:0071456	Process	Cellular response to hypoxia	IMP	20620956
GO:0071479	Process	Cellular response to ionizing radiation	ISS
GO:0071900	Process	Regulation of protein serine/threonine kinase activity	IMP	20203304
GO:0090335	Process	Regulation of brown fat cell differentiation	ISS
GO:0090400	Process	Stress-induced premature senescence	IMP	17916362
GO:0106230	Process	Protein depropionylation	ISS
GO:0106231	Function	Protein-propionyllysine depropionylase activity	ISS
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1900113	Process	Negative regulation of histone H3-K9 trimethylation	IEA
GO:1901215	Process	Negative regulation of neuron death	IEA
GO:1901984	Process	Negative regulation of protein acetylation	IMP	17916362, 20203304
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	ISS	11672522
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	17317627
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1904179	Process	Positive regulation of adipose tissue development	ISS
GO:1990254	Function	Keratin filament binding	IPI	23382074
GO:1990619	Process	Histone H3-K9 deacetylation	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000111	Process	Positive regulation of macrophage apoptotic process	ISS
GO:2000480	Process	Negative regulation of cAMP-dependent protein kinase activity	IDA	20203304
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IMP	18687677
GO:2000619	Process	Negative regulation of histone H4-K16 acetylation	IMP	17916362
GO:2000655	Process	Negative regulation of cellular response to testosterone stimulus	IMP	17505061
GO:2000757	Process	Negative regulation of peptidyl-lysine acetylation	IDA	20100829
GO:2000773	Process	Negative regulation of cellular senescence	IDA	20203304
GO:2000773	Process	Negative regulation of cellular senescence	IMP	20424141
GO:2000774	Process	Positive regulation of cellular senescence	IDA	18687677

Other IDs

• MIM: 604479
• HGNC: 14929
• e!Ensembl: ENSG00000096717

Protein

• UniProt ID: Q96EB6
• Protein name: NAD-dependent protein deacetylase sirtuin-1 (hSIRT1) (EC 2.3.1.286) (NAD-dependent protein deacylase sirtuin-1) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 1) (SIR2-like protein 1) (hSIR2) [Cleaved into: SirtT1 75 kDa fragment (75SirT1)]
• Protein function: NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, response to DNA damage, metabolism, apo
• PDB: 4I5I, 4IF6, 4IG9, 4KXQ, 4ZZH, 4ZZI, 4ZZJ, 5BTR, 8ANB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	261 → 447	Sir2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378}.
• Sequence:

  MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
  PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
  YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
  RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
  NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
  YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
  QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
  QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
  DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
  PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
  KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
  SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
  GDDQEAINEAISVKQEVTDMNYPSNKS

• Sequence length: 747

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways
FoxO signaling pathway
Efferocytosis
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Wnt signaling pathway
Glucagon signaling pathway
Alcoholic liver disease
Amphetamine addiction
MicroRNAs in cancer

Reactome:

Regulation of HSF1-mediated heat shock response
SIRT1 negatively regulates rRNA expression
Regulation of FOXO transcriptional activity by acetylation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675	29892015, 30061737
Autoimmune diseases	Autoimmune Diseases	rs869025224	23993977
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	19839049
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	19839049
Diabetes mellitus	Diabetes Mellitus, Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	24894401, 23834033
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	19839049
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	20068143
Neuronal ceroid lipofuscinosis	Ceroid lipofuscinosis, neuronal 1, infantile	rs118203975, rs118203976, rs118203977, rs267607235, rs140948465, rs1740291234, rs386833969, rs104894385, rs104894386, rs121908292, rs267606738, rs1555274312, rs119455953, rs119455954, rs119455955, rs56144125, rs119455956, rs28940573, rs119455957, rs119455958, rs104894064, rs28940569, rs104894060, rs137852883, rs1555468634, rs121434286, rs267606737, rs104894483, rs397515352, rs774543080, rs121908080, rs786205067, rs137852695, rs137852696, rs137852697, rs137852698, rs137852699, rs137852700, rs137852701, rs137852702, rs63749877, rs121912789, rs121912790, rs786205105, rs154774634, rs587776892, rs387907246, rs386833624, rs386833626, rs386833625, rs386833627, rs386833628, rs386833629, rs386833630, rs386833632, rs386833633, rs386833634, rs386833635, rs386833636, rs386833637, rs386833638, rs386833641, rs386833642, rs386833643, rs386833644, rs386833645, rs386833646, rs386833647, rs386833648, rs386833649, rs386833650, rs386833651, rs386833652, rs386833653, rs148412181, rs386833654, rs386833655, rs386833656, rs386833657, rs386833658, rs386833659, rs386833660, rs386833661, rs386833663, rs386833664, rs386833665, rs386833666, rs386833667, rs386833668, rs386833669, rs386833671, rs386833694, rs386833695, rs386833696, rs386833697, rs386833698, rs386833699, rs386833700, rs386833701, rs386833702, rs386833703, rs386833704, rs386833705, rs386833706, rs386833707, rs386833708, rs386833709, rs386833710, rs386833712, rs386833713, rs386833714, rs386833715, rs386833717, rs386833720, rs386833721, rs386833722, rs386833724, rs386833725, rs386833726, rs386833728, rs386833729, rs386833730, rs386833731, rs386833732, rs386833735, rs386833736, rs386833737, rs386833739, rs386833740, rs386833741, rs386833742, rs386833743, rs386833744, rs386833963, rs386833964, rs386833965, rs386833966, rs386833967, rs386833970, rs386833971, rs386833972, rs386833973, rs386833974, rs386833975, rs386833978, rs386833979, rs386833980, rs386833981, rs386833982, rs386833983, rs386834123, rs386834124, rs386834125, rs386834126, rs386834128, rs386834130, rs386834132, rs386834133, rs386834135, rs34238807, rs386834138, rs386834139, rs397514731, rs397514732, rs753084727, rs587778809, rs154774640, rs154774639, rs121908197, rs121908198, rs121908199, rs121908200, rs121908201, rs121908203, rs121908202, rs121908195, rs121908204, rs121908205, rs121908209, rs121908207, rs104895127, rs63750411, rs587779397, rs587780315, rs724159970, rs727502800, rs727502801, rs724159971, rs746645358, rs786204553, rs786204753, rs778232650, rs786204644, rs794727955, rs794729218, rs796052925, rs796052923, rs796052927, rs558274487, rs796052752, rs144495588, rs1554901472, rs750428882, rs796053439, rs763162812, rs756564767, rs202189057, rs759080581, rs746085696, rs546989392, rs143781303, rs796052356, rs796052351, rs796052335, rs797045136, rs797045137, rs765097897, rs864309505, rs869025274, rs869312751, rs1085307087, rs878853322, rs878853325, rs878853929, rs878855053, rs878855331, rs553522118, rs748710466, rs886041568, rs886041487, rs886041546, rs1057516575, rs1057516889, rs1057517401, rs1057516447, rs1057517049, rs1057517192, rs1057517368, rs1057517112, rs747204624, rs1057516867, rs1057516582, rs756267448, rs1057516579, rs1057516511, rs1057516264, rs1057516319, rs113019349, rs1057517313, rs1057516945, rs752164603, rs1057516366, rs1057516667, rs1057516814, rs780198002, rs1057517134, rs1057516390, rs764495616, rs750935331, rs1057516677, rs1057516267, rs771788391, rs1057517350, rs1057516335, rs1057517287, rs1057517215, rs1057516343, rs777625354, rs764051026, rs559155109, rs1064796787, rs139842473, rs1064794233, rs181995380, rs1064795153, rs752612332, rs1131691676, rs1131691539, rs1555438255, rs1555058286, rs1555274005, rs1555468632, rs200348035, rs1265044710, rs1439582451, rs751696703, rs761621368, rs143730802, rs1554901580, rs1554902052, rs1553950197, rs200319160, rs143657539, rs1554901523, rs1555274338, rs1555273604, rs1555273881, rs1216139602, rs762226836, rs1553167863, rs1553166135, rs1553166147, rs1553167430, rs1349528345, rs1553166499, rs1553166337, rs1553167415, rs1553167474, rs1553167479, rs1554451504, rs746397087, rs1554449028, rs759830733, rs1554449124, rs554042394, rs1554451484, rs1554448874, rs1554448924, rs1554449047, rs1554449136, rs1554901463, rs1184563885, rs1554902043, rs763961289, rs1407106889, rs1554901576, rs1554901731, rs1424116749, rs1554901784, rs1554902216, rs779615685, rs1554902085, rs764790770, rs1555274343, rs1555274369, rs1555273567, rs1555274365, rs1555273609, rs1555274344, rs1555274373, rs1555274387, rs1451777867, rs762902907, rs756522171, rs1555438212, rs1555438443, rs1555468374, rs1555469452, rs1555467473, rs1418997146, rs1555273882, rs1478660606, rs1555273992, rs1555274014, rs1555274337, rs142456044, rs1555469159, rs758921701, rs1555469089, rs1555469477, rs1554901898, rs1554902217, rs1564855860, rs1564854729, rs1460276679, rs1560776422, rs556661896, rs868732642, rs1564855725, rs1566219136, rs1381427322, rs1557714302, rs1593914689, rs1302326945, rs1570470281, rs1570476221, rs775699005, rs1578912362, rs750162094, rs759664259, rs1589947644, rs1012449574, rs1570467252, rs778875017, rs1578794927, rs1578912759, rs1314967038, rs1465284719, rs1595816465, rs1595816474, rs1596563048, rs1565311875, rs2046113301, rs1578889355, rs776253867, rs1649597261, rs1649901192, rs749315686, rs1801297484, rs764256845, rs1242337070, rs2034349431, rs1380684360, rs1648444864, rs1739594685, rs1736369601, rs1739482158, rs1471253353, rs2046243804, rs1845791308, rs1397197980, rs2046158549	21224254
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs193922650, rs193922685, rs193922687, rs751160202, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829	24184811
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	21062352
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21882241, 20977650

Unknown
Disease term	Disease name	Evidence	References	Source
Atherosclerosis	Atherosclerosis		20068143	ClinVar
Brain neoplasms	Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain		22523472	ClinVar
Cirrhosis	Cirrhosis		20651248	ClinVar
Congestive heart failure	Congestive heart failure		24535859	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided		24535859	ClinVar
Myocardial infarction	Myocardial Failure		24535859	ClinVar
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation		29892015	ClinVar
Atrial Fibrillation	Atrial Fibrillation			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Acrocephalosyndactylia	Associate	30158377
Acute Coronary Syndrome	Inhibit	23382833, 25342474
Acute Coronary Syndrome	Associate	25342474
Acute Kidney Injury	Inhibit	30980521
Acute Kidney Injury	Associate	38062807
Acute Lung Injury	Associate	25972997, 35853732
Adenocarcinoma	Associate	19649206, 25915617, 33341453
Adenocarcinoma of Lung	Associate	19649206, 30841451, 37898426
Adrenal Cortex Neoplasms	Associate	33650791
Aging Premature	Associate	35811457, 38004107
Albuminuria	Associate	32887498
Allergic Fungal Sinusitis	Associate	33000196
Alzheimer Disease	Associate	19558452, 26010513, 26827652, 27687218, 29855513, 31175839, 31370365, 32348224, 36035216
Alzheimer Disease	Inhibit	27522594, 28578695, 33834065
Alzheimer Disease	Stimulate	36073820
Angina Unstable	Inhibit	25342474
Anodontia	Associate	29363918, 33318474
Antisocial Personality Disorder	Associate	28439078
Anxiety Disorders	Associate	26509718
Aortic Aneurysm Abdominal	Associate	32138469
Arthritis	Associate	23257246, 28329314
Arthritis Psoriatic	Associate	21931678, 27496874
Arthritis Rheumatoid	Associate	21742641, 32692720, 33215529, 38225924
Arthritis Rheumatoid	Inhibit	25799392, 29784872
Arthritis Rheumatoid	Stimulate	34431434
Asthma	Inhibit	30654657
Asthma	Associate	37274900
Atherosclerosis	Associate	20068143, 24378473, 24859347, 24973384, 25273948, 25706717, 27123454, 31023999, 31901246
Atherosclerosis	Inhibit	23382833, 28765952
Autoimmune Diseases	Associate	23473037, 27245255, 32485674
Behcet Syndrome	Inhibit	33142293
Benign Paroxysmal Positional Vertigo	Associate	27203679
Bipolar Disorder	Associate	38012695
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	28856724, 32967053
Brain Diseases	Associate	37098490
Brain Injuries	Associate	36506933
Breast Neoplasms	Associate	19047049, 20412117, 23169992, 23340254, 24126058, 24897117, 25139823, 25420528, 26459286, 26999517, 28882183, 29752439, 30409902, 30697969, 30982660, 31101119, 32681437, 34663249, 35250881, 36322753, 37433152, 40604083
Breast Neoplasms	Stimulate	21596753, 26999517
Breast Neoplasms	Inhibit	22190494
Bronchitis Chronic	Associate	39682757
Calcinosis	Inhibit	32402066
Cap Myopathy	Associate	26988912
Carcinogenesis	Associate	19649206, 20412117, 20670893, 21527554, 23255128, 23800187, 23805287, 24416313, 25420528, 25485577, 25791281, 26959057, 27708228, 27746184, 28061480, 28351313, 28882183, 30016782, 30410074, 30710424, 31931863, 32098999, 32714081, 34719479
Carcinoma Ductal	Stimulate	23340254
Carcinoma Hepatocellular	Stimulate	21527554
Carcinoma Hepatocellular	Associate	22302044, 22448750, 22728651, 23814050, 24416313, 28242208, 28720061, 28983625, 29630527, 30841449, 31056532, 32714081, 33955831, 34348664, 34981667, 35961004, 36308411, 37715252, 39617695
Carcinoma Non Small Cell Lung	Associate	24228097, 25184156, 25915617, 26096576, 28498463, 29552768, 30710424, 32267139, 33819917, 34696659, 35029291, 37851987
Carcinoma Ovarian Epithelial	Associate	29050034, 34590923
Carcinoma Pancreatic Ductal	Associate	24088390, 26121130, 27170223
Carcinoma Renal Cell	Associate	30518708, 33907836, 38427808
Carcinoma Renal Cell	Stimulate	37096064
Carcinoma Squamous Cell	Associate	19649206, 23354305, 25794641, 35212616
Cardiomyopathies	Inhibit	32460327, 35387565
Cardiomyopathies	Associate	38012584
Cardiomyopathy Dilated	Inhibit	33303703
Cardiomyopathy Restrictive	Stimulate	18791640
Cardiomyopathy Restrictive	Associate	19806227
Cardiovascular Diseases	Associate	24587358, 27841908, 32733639, 33249778, 35092334
Carotid Artery Diseases	Associate	25273948
Carotid Artery Thrombosis	Associate	31450612
Cataract	Associate	31287252, 31582653, 35184653
Cataract Age Related Nuclear	Associate	21527554, 31287252
Cerebral Infarction	Associate	28965081, 38245621
Cerebrovascular Disorders	Associate	31257461, 35968712
Cholangiocarcinoma	Associate	39940750
Cholangitis Sclerosing	Associate	38302916
Cockayne Syndrome	Associate	23267107
Cognition Disorders	Associate	28329314, 31305452
Cognitive Dysfunction	Associate	31305452, 33447019
Colitis Ulcerative	Associate	23473037, 38302916
Colonic Neoplasms	Associate	27540973, 39494323
Colorectal Neoplasms	Associate	16596166, 18755897, 19430421, 22190494, 23045412, 26959057, 28708932, 29363918, 30257253, 30410074, 30451820, 31213086, 32098999, 32393998, 32605336, 33455111, 34660182, 37575080, 38214831, 39494323
CoQ responsive OXPHOS deficiency	Associate	37816710
Coronary Artery Disease	Inhibit	23382833
Coronary Artery Disease	Associate	25342474, 27123454, 27841908, 28601780, 33249778, 35224092, 39680523
Coronary Artery Disease	Stimulate	30192743, 35224092
Coronary Disease	Inhibit	35038972
Coronary Disease	Associate	35092334, 35469171, 36145164, 37730614, 39680523
COVID 19	Inhibit	33578018
COVID 19	Associate	35390032
Cytokine Release Syndrome	Associate	33022863
Deafness	Associate	28329314
Dementia	Inhibit	28578695
Dementia	Associate	29855513
Depressive Disorder	Associate	26176920, 26509718
Depressive Disorder	Inhibit	33834065
Depressive Disorder Major	Associate	26176920, 30482883
Diabetes Complications	Associate	27123454, 30901315
Diabetes Gestational	Associate	24549598, 30513672, 40243583
Diabetes Gestational	Inhibit	30125412, 32365792, 34149611, 38326276
Diabetes Mellitus	Associate	19806227, 21813271, 21871827, 22228742, 26010513, 27841908, 29302057, 30513672, 32402066, 33249778, 38283900
Diabetes Mellitus	Stimulate	25815791, 32627000
Diabetes Mellitus	Inhibit	30184318, 32887498, 34149611
Diabetes Mellitus Type 1	Inhibit	21813271, 30736780
Diabetes Mellitus Type 1	Associate	23473037, 29027826, 33249778, 34439776
Diabetes Mellitus Type 2	Associate	19014491, 21331741, 21556116, 21871827, 22228742, 23133645, 25342474, 26637398, 27123454, 28860538, 29995800, 30139387, 30367115, 30504713, 30513672, 33577446, 35092334, 35365152, 35469171, 35778952
Diabetes Mellitus Type 2	Inhibit	27904654, 29330620, 30736780
Diabetes Mellitus Type 2	Stimulate	36915137
Diabetic Foot	Associate	29995800, 33096729, 37985432
Diabetic Nephropathies	Associate	21331741, 28860538, 29848325, 33279869, 33577446, 38270305
Diabetic Nephropathies	Inhibit	32705273
Diabetic Retinopathy	Associate	32572899, 32698791, 33022863, 33974755, 34937832, 36238483
Disease	Associate	31219487
DNA Virus Infections	Associate	30902968
Dowling Degos Disease	Associate	25503852
Down Syndrome	Associate	23291000
Drug Related Side Effects and Adverse Reactions	Associate	21130087, 25961951, 32710757, 33355373, 37816710
Drug Resistant Epilepsy	Associate	38447234
Duane Retraction Syndrome	Associate	33974755
Encephalitis Herpes Simplex	Associate	36555725
Endometrial Neoplasms	Associate	26701732, 31131636, 32388637
Endometriosis	Associate	31906251
Endometriosis	Stimulate	34698105
Enterocolitis Necrotizing	Associate	29276042
Enterocolitis Necrotizing	Inhibit	32657204
Epiphyseal dysplasia multiple 1	Inhibit	21337390
Esophageal Neoplasms	Stimulate	30945643
Esophageal Neoplasms	Associate	31684999
Esophageal Squamous Cell Carcinoma	Associate	26662958, 29636061, 31170665, 32846774, 36510377
Fatigue Syndrome Chronic	Associate	34011981
Fatty Liver	Associate	30154382, 31183612
Fetal Growth Retardation	Associate	26051094
Fetal Growth Retardation	Inhibit	30125412, 37661175
Fever	Associate	24728004, 40724923
Fibrocartilaginous embolism	Associate	22990594, 25503852, 26505388, 26752489, 31706101, 32572902, 34222486
Fibrosis	Associate	29848325, 38062807
Fibrosis	Inhibit	32705273
Fragile X Syndrome	Associate	18369442
Gaucher Disease	Inhibit	32485674
Glioblastoma	Associate	22318540, 26345416, 31319814, 32186433, 37100462
Glioblastoma	Stimulate	26662303
Glioma	Associate	21655185, 22318540, 24488909, 25791281, 27166997, 31319814, 31957839, 37277492
Glomerulonephritis IGA	Associate	32791747
Glucose Intolerance	Stimulate	19504086
Glut1 Deficiency Syndrome	Associate	32657204
Glycogen Storage Disease IB	Associate	35961004
Glycogen Storage Disease Type II	Associate	32051464, 35961004
Granulosa Cell Tumor	Associate	33669567
Graves Disease	Associate	27245255
Graves Disease	Inhibit	32485674
HAIR AN syndrome	Inhibit	36726289
Hashimoto Disease	Associate	33916948, 34439776
Heart Diseases	Inhibit	32460327
Heart Diseases	Associate	34439776
Heart Failure	Inhibit	26233702
Heart Failure	Associate	32460327, 33576462, 35092334
Heat Stroke	Associate	35853732
Helicobacter Infections	Associate	33641223
Hematologic Neoplasms	Associate	27725192
Hemolytic Uremic Syndrome	Inhibit	39510246
Hepatic Encephalopathy	Associate	38062807
Hepatitis Alcoholic	Associate	27669435
Hepatitis C Chronic	Associate	32089410
Hepatoblastoma	Associate	31646606
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16596166, 20160719
Hereditary leiomyomatosis and renal cell cancer	Associate	26722524
Hirschsprung Disease	Associate	39494277
HIV Infections	Associate	35159154
Hodgkin Disease	Associate	26722524
Hyperglycemia	Associate	27542238, 34509564, 34639171, 36073820
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	30513672
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	36073820
Hyperoxia	Associate	26465873
Hyperplasia	Inhibit	29784872
Hypersensitivity Immediate	Associate	32840960
Hypertension	Associate	25273948, 32887498
Hypertrophy	Associate	21337390, 35703318
Hypopharyngeal Neoplasms	Associate	23805287
Hypothermia	Associate	25654745
Hypothyroidism	Inhibit	30736780
Hypoxia	Associate	22302044, 22448750, 30843674, 33318474, 35042949, 36725745
Hypoxia Brain	Associate	22448750
Idiopathic Pulmonary Fibrosis	Associate	32851507
Immunoglobulin G4 Related Disease	Associate	33507936
Infections	Associate	31914379
Infertility Male	Associate	29359516
Inflammation	Associate	22689577, 23257246, 23382833, 23636469, 24036938, 24962570, 25172416, 25706717, 25905433, 26556603, 26718495, 27123454, 27125385, 27687218, 28257794, 28601780, 28726780, 29095837, 29138552, 29411515, 30513672, 30791744, 31023999, 31706101, 32098999, 32106619, 32270742, 32286137, 32657204, 32831997, 33022863, 33142293, 33311978, 33355373, 33577446, 33578018, 33762567, 33974755, 34471421, 34590155, 34907823, 34982643, 35109750, 35293599, 35293601, 35594394, 35730622, 35811457, 36145164, 36301023, 36555725, 36725745, 37203402, 37274900, 38225924, 38245621, 38283900, 40076701
Inflammation	Inhibit	24859347, 29784872, 30037017, 30101822, 32572902, 34011981, 34078001, 34431434, 37175520, 37730614, 38447234
Insulin Resistance	Associate	17908551, 26637398, 27955950, 29417372, 30385096, 34034759, 37862340
Insulin Resistance	Inhibit	20068143
Intervertebral Disc Degeneration	Associate	22152608, 22990594, 25503852, 26505388, 26940203, 32572902, 34222486, 35762319
Intervertebral Disc Degeneration	Inhibit	26752489
Intervertebral disc disease	Associate	22152608
Intestinal Pseudo Obstruction	Associate	23933590
Intracranial Arteriovenous Malformations	Associate	36292575
Ischemia	Associate	28965081
Kidney Diseases	Associate	30980521, 31719572, 32887498
Kidney Failure Chronic	Associate	35092334
Kidney Neoplasms	Associate	37047552
Laron Syndrome	Associate	34769292
Leukemia	Associate	21818379, 32037392, 36322781
Leukemia Lymphocytic Chronic B Cell	Associate	26036258, 26794150
Leukemia Lymphoma Adult T Cell	Associate	26063426, 31614144
Leukemia Lymphoma Adult T Cell	Inhibit	33630973
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22410779, 24967705, 26157347
Leukemia Myeloid Acute	Stimulate	27725192
Leukemia Myeloid Acute	Associate	28272704, 30134922, 32037392
Leukemia T Cell	Associate	36322781
Lewy Body Disease	Inhibit	28578695
Lipid Metabolism Disorders	Associate	38427808
Liposarcoma	Associate	32493092
Liver Cirrhosis	Associate	32089410
Liver Diseases	Associate	23510538, 24446069, 40268458
Liver Neoplasms	Associate	28288414
Lumbar Stenosis Familial	Associate	22152608
Lung Diseases	Associate	35042949
Lung Injury	Associate	27125385
Lung Neoplasms	Associate	19649206, 24728004, 25915617, 26317794, 27528025, 28498463, 30016782, 30058691, 30988280, 33709560, 34947995, 39313797
Lung Neoplasms	Stimulate	25184156
Lupus Erythematosus Systemic	Associate	31914379, 33584646
Lymphatic Diseases	Associate	25146318
Lymphatic Metastasis	Associate	23768087, 23805287, 26515337, 32846774
Lymphatic Metastasis	Stimulate	27170223
Lymphoma	Associate	23681230
Lymphoma Follicular	Associate	28324774
Lymphoma Large B Cell Diffuse	Associate	28324774, 37816710
Lymphoma T Cell	Associate	27124741
Lymphoma T Cell Peripheral	Associate	25674239
Macular Degeneration	Associate	24036938, 26656366, 27998274, 34982643
Malformations of Cortical Development Group I	Associate	26354378, 32831997
Malnutrition	Associate	22228742
Mandibuloacral dysplasia with type A lipodystrophy	Associate	25324471
Medulloblastoma	Associate	28440450
Melanoma	Associate	24742694, 24751483, 24850177, 28882678, 31292999
Melanoma	Stimulate	24743044, 29374154
Mental Disorders	Associate	28439078
Metabolic Diseases	Associate	19786632, 21813271, 22064865, 22378745, 23636469, 37862340
Metabolic Syndrome	Associate	19806227, 35365152
Metabolic Syndrome	Inhibit	20068143
Microvascular Angina	Associate	35968712
Mitochondrial Diseases	Associate	20697895, 24446069, 25961951, 27998274, 30385096, 31881011, 32286137, 32692720, 34214916, 35364376
Mitochondrial Diseases	Inhibit	37949849
Mouth Neoplasms	Inhibit	37949849
Multiple Myeloma	Associate	23759586
Multiple Sclerosis	Associate	25136908, 36949521, 38003363
Multiple Sclerosis Relapsing Remitting	Associate	25136908
Muscular Atrophy	Inhibit	38004107
Myocardial Infarction	Inhibit	25342474
Myocardial Infarction	Associate	25654745, 25706717, 28329314, 29664427, 33879068, 35092334, 37930868
Myopathy with Giant Abnormal Mitochondria	Associate	36525817
Necrosis	Associate	38427808
Neoplasm Invasiveness	Stimulate	25146318
Neoplasm Metastasis	Associate	22249256, 24019980, 26515337, 27166997, 28351313, 29374154, 31131636, 31957839, 32267139, 35029291, 36289222
Neoplasm Metastasis	Stimulate	24228097, 32714081, 37575080
Neoplasms	Associate	12297502, 16354677, 16596166, 16638127, 18704159, 18723829, 19430421, 20412117, 21527554, 21957481, 22124156, 22410779, 22982396, 23045412, 23255128, 23800187, 23805287, 24019980, 24088390, 24362520, 24751483, 25032863, 25139823, 25146318, 25189993, 25791281, 26157347, 26416354, 26515337, 26662958, 26722524, 26891914, 26959057, 27124741, 27170223, 27384990, 27793057, 28122359, 28272704, 28324774, 28351313, 28582846, 28632727, 28904318, 29374154, 29436693, 29632297, 29693338, 30016782, 30058691, 30451820, 30518708, 30710424, 30902968, 30945643, 31092575, 31131636, 31684999, 32098999, 32286137, 32366480, 32388637, 32393998, 32493092, 32541517, 32710757, 32761762, 32846774, 32998713, 34719479, 35192680, 35587604, 36366450, 36510377, 37294601, 37575080, 38283900, 38427808
Neoplasms	Inhibit	19649206, 22064865, 23354305, 24258275, 24742694, 25946975, 27725192, 27935866, 28797320, 29050728, 29363918, 33650791, 35686673, 37949849
Neoplasms	Stimulate	25184156
Neoplasms Adipose Tissue	Associate	37730614
Neoplasms Glandular and Epithelial	Associate	26465873, 28904318, 35853732
Nephrotic Syndrome	Associate	32270742
Nerve Degeneration	Associate	32831997, 33318474
Nerve Degeneration	Inhibit	34222486
Nervous System Diseases	Associate	25991017
Neuralgia	Inhibit	27646435
Neuroblastoma	Associate	19285077
Neuroblastoma	Stimulate	37446264
Neurodegenerative Diseases	Associate	22584570, 28578695, 33834065, 36725745, 38283900
Neuroma Acoustic	Associate	30953268
Neurotoxicity Syndromes	Associate	39441175
NOG Related Symphalangism Spectrum Disorder	Associate	21702042
Non alcoholic Fatty Liver Disease	Associate	22560219, 27756894, 31195981, 38533551
Obesity	Associate	19430421, 20335544, 21760635, 21871827, 22310473, 23933590, 27125385, 29428938, 33612619, 35811457, 38283900, 38533551
Obesity	Inhibit	29417372, 30409902, 35968712, 37862340
Obesity Abdominal	Associate	23933590, 33612619
Obesity Maternal	Stimulate	26513002
Optic Neuritis	Associate	36949521
Oropharyngeal Neoplasms	Associate	38167952
Osteoarthritis	Associate	19714620, 23143889, 32395770, 33942704, 35594394, 35894157, 36915137, 38554527
Osteoarthritis	Inhibit	21337390, 27863529, 31072129
Osteoarthritis Knee	Associate	27863529
Osteoglophonic dwarfism	Inhibit	33355373
Osteophyte	Associate	35594394
Osteoporosis	Associate	23255128, 23473037, 28339869, 28751929, 31486477, 34711685, 35159154, 36046997, 36682830, 36840968
Osteosarcoma	Associate	23877372, 28059051, 28632727, 28810936, 31390921
Ovarian Neoplasms	Associate	25323003, 28214851, 28365935, 29050034, 31839623, 32388637, 33921111, 34590923
Ovarian Neoplasms	Inhibit	32541517
Pain	Associate	27646435
Pancreatic Neoplasms	Associate	21909380, 24088390, 24484175, 25172416, 27170223, 28351313, 37138146
Pancreatitis Chronic	Associate	25172416
Parkinson Disease	Associate	25991017, 26768367, 30718471, 31214610, 34021216, 34204164, 36352829
Parkinson Disease	Inhibit	28578695
Parkinson Disease	Stimulate	37446264
Periapical Granuloma	Associate	30101822
Periapical Periodontitis	Associate	30101822
Periodontitis	Associate	35630070
Peripheral Arterial Disease	Associate	35092334
Peroxisomal Disorders	Associate	31257461
Persistent Infection	Associate	33249778
Personality Disorders	Inhibit	29784872
Personality Disorders	Associate	30982660
Pituitary Neoplasms	Associate	31747893
Plaque Atherosclerotic	Associate	31023999
Polycystic Ovary Syndrome	Associate	36286390
Polyneuropathies	Associate	37175520
Pre Eclampsia	Associate	26051094, 28161061, 40243583
Pre Eclampsia	Inhibit	37966393
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	25884180
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	36322781
Prostatic Intraepithelial Neoplasia	Inhibit	24127549
Prostatic Neoplasms	Associate	15692560, 17505061, 18637271, 19075016, 19377286, 22249256, 23169992, 23658738, 24127549, 24713434, 24892674, 25870236, 26439987, 26847404, 26988912, 30024932, 31092575, 34171447
Prostatitis	Associate	24127549
Psoriasis	Associate	26556603, 27496874
Pulmonary Arterial Hypertension	Associate	33143333, 35042949
Pulmonary Disease Chronic Obstructive	Inhibit	18174544, 27767101, 27784320, 29861836, 32270742, 33762567
Pulmonary Disease Chronic Obstructive	Associate	23897750, 25905433, 29138552, 29411515, 29976774, 33311978, 39682757
Radiation Injuries	Associate	22302044
Recurrence	Stimulate	31219487
Renal Tubular Transport Inborn Errors	Associate	29848325
Reperfusion Injury	Associate	34868528, 38012584
Retinal Degeneration	Associate	24036938
Retinal Diseases	Associate	27998274
Retinal Vein Occlusion	Inhibit	33036304
Rhinitis Allergic	Associate	37274900
Ring Chromosome 20 Syndrome	Inhibit	33318474, 33355373
Sarcoma	Associate	24019980
Sarcoma Ewing	Associate	26055805
Schizophrenia	Associate	20977650
Scoliosis	Associate	22152608
Sepsis	Associate	30980521
Silicosiderosis	Associate	35594394
Sleep Apnea Obstructive	Inhibit	31552414
Smooth Muscle Tumor	Associate	38012555
Squamous Cell Carcinoma of Head and Neck	Associate	23475622, 23805287, 25946975, 31931863, 34384029, 34719479
Squamous Cell Carcinoma of Head and Neck	Inhibit	29050728
Squamous Intraepithelial Lesions	Stimulate	25794641
ST Elevation Myocardial Infarction	Associate	29664427
Stomach Neoplasms	Associate	22363646, 23768087, 25033286, 25146318, 25815791, 27384994, 28061480, 28070138, 28122359, 29363918, 29436693, 29693338, 30945643, 31352788, 31423013, 32508267, 35502827
Stroke	Associate	36725745
Subarachnoid Hemorrhage	Associate	36506933
Telomeric 22q13 Monosomy Syndrome	Associate	21527554
Tertiary Lymphoid Structures	Associate	25420528
Thrombosis	Associate	31450612
Thyroid Cancer Papillary	Associate	27793057
Thyroid Neoplasms	Stimulate	27793057
Thyroiditis Autoimmune	Associate	27245255, 34439776
Triple Negative Breast Neoplasms	Associate	26236947, 26459286, 26515337
Triple Negative Breast Neoplasms	Inhibit	30982660, 32681437
Tuberculosis Multidrug Resistant	Associate	25471124
Urinary Bladder Neoplasms	Associate	27367652, 31219487, 36314337
Uterine Cervical Neoplasms	Associate	20157519, 25794641, 28275188, 28797320, 35587604, 40460909
Uterine Cervicitis	Associate	32938703
Uterine Neoplasms	Associate	32388637
Uveal melanoma	Associate	26940009
Vascular Calcification	Associate	32402066, 38012555
Vascular Diseases	Associate	32627000, 34850960
Vascular System Injuries	Associate	37187128
Vasculitis	Inhibit	34950150
Vitiligo	Associate	24410795
Weight Gain	Associate	27125385
Weight Loss	Associate	22310473
Weight Loss	Stimulate	30385096
Wolman Disease	Associate	32365792
Wounds and Injuries	Associate	30843674
Xeroderma Pigmentosum Complementation Group D	Associate	23267107