Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23410
Gene name Gene Name - the full gene name approved by the HGNC.	Sirtuin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SIRT3
Synonyms (NCBI Gene) Gene synonyms aliases	SIR2L3
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent th

Show/Hide all(222)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732205	hsa-miR-421	Luciferase reporter assay	27107702
MIRT732205	hsa-miR-421	Luciferase reporter assay	27107702
MIRT734872	hsa-miR-505-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunocytochemistry (ICC)	33385630
MIRT734872	hsa-miR-505-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34646424
MIRT1350159	hsa-miR-1	CLIP-seq
MIRT1350160	hsa-miR-106a	CLIP-seq
MIRT1350161	hsa-miR-106b	CLIP-seq
MIRT1350162	hsa-miR-1225-5p	CLIP-seq
MIRT1350163	hsa-miR-128	CLIP-seq
MIRT1350164	hsa-miR-1287	CLIP-seq
MIRT1350165	hsa-miR-1298	CLIP-seq
MIRT1350166	hsa-miR-1299	CLIP-seq
MIRT1350167	hsa-miR-17	CLIP-seq
MIRT1350168	hsa-miR-185	CLIP-seq
MIRT1350169	hsa-miR-206	CLIP-seq
MIRT1350170	hsa-miR-20a	CLIP-seq
MIRT1350171	hsa-miR-20b	CLIP-seq
MIRT1350172	hsa-miR-24	CLIP-seq
MIRT1350173	hsa-miR-302a	CLIP-seq
MIRT1350174	hsa-miR-302b	CLIP-seq
MIRT1350175	hsa-miR-302c	CLIP-seq
MIRT1350176	hsa-miR-302d	CLIP-seq
MIRT1350177	hsa-miR-302e	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT1350179	hsa-miR-3135b	CLIP-seq
MIRT1350180	hsa-miR-3150b-3p	CLIP-seq
MIRT1350181	hsa-miR-3655	CLIP-seq
MIRT1350182	hsa-miR-3673	CLIP-seq
MIRT1350183	hsa-miR-3685	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT1350186	hsa-miR-372	CLIP-seq
MIRT1350187	hsa-miR-373	CLIP-seq
MIRT1350188	hsa-miR-384	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT1350190	hsa-miR-3929	CLIP-seq
MIRT1350191	hsa-miR-4269	CLIP-seq
MIRT1350192	hsa-miR-4272	CLIP-seq
MIRT1350193	hsa-miR-4284	CLIP-seq
MIRT1350194	hsa-miR-4306	CLIP-seq
MIRT1350195	hsa-miR-4323	CLIP-seq
MIRT1350196	hsa-miR-4328	CLIP-seq
MIRT1350197	hsa-miR-4419b	CLIP-seq
MIRT1350198	hsa-miR-4434	CLIP-seq
MIRT1350199	hsa-miR-4478	CLIP-seq
MIRT1350200	hsa-miR-450b-3p	CLIP-seq
MIRT1350201	hsa-miR-4514	CLIP-seq
MIRT1350202	hsa-miR-4516	CLIP-seq
MIRT1350203	hsa-miR-4637	CLIP-seq
MIRT1350204	hsa-miR-4640-5p	CLIP-seq
MIRT1350205	hsa-miR-4644	CLIP-seq
MIRT1350206	hsa-miR-4645-5p	CLIP-seq
MIRT1350207	hsa-miR-4673	CLIP-seq
MIRT1350208	hsa-miR-4692	CLIP-seq
MIRT1350209	hsa-miR-4709-5p	CLIP-seq
MIRT1350210	hsa-miR-4726-5p	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT1350212	hsa-miR-4742-5p	CLIP-seq
MIRT1350213	hsa-miR-4755-3p	CLIP-seq
MIRT1350214	hsa-miR-4768-3p	CLIP-seq
MIRT1350215	hsa-miR-4782-5p	CLIP-seq
MIRT1350216	hsa-miR-4784	CLIP-seq
MIRT1350217	hsa-miR-4802-5p	CLIP-seq
MIRT1350218	hsa-miR-485-5p	CLIP-seq
MIRT1350219	hsa-miR-496	CLIP-seq
MIRT1350220	hsa-miR-512-3p	CLIP-seq
MIRT1350221	hsa-miR-516b	CLIP-seq
MIRT1350222	hsa-miR-519d	CLIP-seq
MIRT1350223	hsa-miR-520a-3p	CLIP-seq
MIRT1350224	hsa-miR-520b	CLIP-seq
MIRT1350225	hsa-miR-520c-3p	CLIP-seq
MIRT1350226	hsa-miR-520d-3p	CLIP-seq
MIRT1350227	hsa-miR-520e	CLIP-seq
MIRT1350228	hsa-miR-613	CLIP-seq
MIRT1350229	hsa-miR-661	CLIP-seq
MIRT1350230	hsa-miR-665	CLIP-seq
MIRT1350231	hsa-miR-765	CLIP-seq
MIRT1350232	hsa-miR-769-3p	CLIP-seq
MIRT1350233	hsa-miR-875-3p	CLIP-seq
MIRT1350234	hsa-miR-93	CLIP-seq
MIRT1350163	hsa-miR-128	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350236	hsa-miR-1912	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT1350172	hsa-miR-24	CLIP-seq
MIRT1350238	hsa-miR-3130-5p	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT1350191	hsa-miR-4269	CLIP-seq
MIRT1350193	hsa-miR-4284	CLIP-seq
MIRT1350240	hsa-miR-4482	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT1350204	hsa-miR-4640-5p	CLIP-seq
MIRT1350206	hsa-miR-4645-5p	CLIP-seq
MIRT1350207	hsa-miR-4673	CLIP-seq
MIRT1350210	hsa-miR-4726-5p	CLIP-seq
MIRT1350213	hsa-miR-4755-3p	CLIP-seq
MIRT1350214	hsa-miR-4768-3p	CLIP-seq
MIRT1350230	hsa-miR-665	CLIP-seq
MIRT1350166	hsa-miR-1299	CLIP-seq
MIRT1350168	hsa-miR-185	CLIP-seq
MIRT2103740	hsa-miR-3120-3p	CLIP-seq
MIRT1350180	hsa-miR-3150b-3p	CLIP-seq
MIRT1350190	hsa-miR-3929	CLIP-seq
MIRT1350194	hsa-miR-4306	CLIP-seq
MIRT1350197	hsa-miR-4419b	CLIP-seq
MIRT1350199	hsa-miR-4478	CLIP-seq
MIRT2103741	hsa-miR-4501	CLIP-seq
MIRT1350201	hsa-miR-4514	CLIP-seq
MIRT1350205	hsa-miR-4644	CLIP-seq
MIRT1350208	hsa-miR-4692	CLIP-seq
MIRT2103742	hsa-miR-4709-3p	CLIP-seq
MIRT1350209	hsa-miR-4709-5p	CLIP-seq
MIRT1350215	hsa-miR-4782-5p	CLIP-seq
MIRT1350216	hsa-miR-4784	CLIP-seq
MIRT1350217	hsa-miR-4802-5p	CLIP-seq
MIRT1350218	hsa-miR-485-5p	CLIP-seq
MIRT1350219	hsa-miR-496	CLIP-seq
MIRT2103743	hsa-miR-505	CLIP-seq
MIRT1350221	hsa-miR-516b	CLIP-seq
MIRT2103744	hsa-miR-545	CLIP-seq
MIRT1350231	hsa-miR-765	CLIP-seq
MIRT2327876	hsa-miR-1265	CLIP-seq
MIRT2327877	hsa-miR-127-5p	CLIP-seq
MIRT2327878	hsa-miR-1293	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT2327879	hsa-miR-3165	CLIP-seq
MIRT2327880	hsa-miR-3173-3p	CLIP-seq
MIRT2327881	hsa-miR-323b-3p	CLIP-seq
MIRT2327882	hsa-miR-3605-5p	CLIP-seq
MIRT2327883	hsa-miR-3614-5p	CLIP-seq
MIRT2327884	hsa-miR-3665	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT2327885	hsa-miR-3691-5p	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT2327886	hsa-miR-3926	CLIP-seq
MIRT2327887	hsa-miR-3944-5p	CLIP-seq
MIRT2327888	hsa-miR-4277	CLIP-seq
MIRT2327889	hsa-miR-4419a	CLIP-seq
MIRT2327890	hsa-miR-4483	CLIP-seq
MIRT2327891	hsa-miR-4491	CLIP-seq
MIRT2327892	hsa-miR-4510	CLIP-seq
MIRT1350201	hsa-miR-4514	CLIP-seq
MIRT2327893	hsa-miR-4533	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT2327894	hsa-miR-4657	CLIP-seq
MIRT1350208	hsa-miR-4692	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT2327895	hsa-miR-4752	CLIP-seq
MIRT2327896	hsa-miR-4764-5p	CLIP-seq
MIRT2327897	hsa-miR-4786-3p	CLIP-seq
MIRT2327898	hsa-miR-4786-5p	CLIP-seq
MIRT2327899	hsa-miR-548p	CLIP-seq
MIRT2327900	hsa-miR-548s	CLIP-seq
MIRT2327901	hsa-miR-657	CLIP-seq
MIRT1350230	hsa-miR-665	CLIP-seq
MIRT1350180	hsa-miR-3150b-3p	CLIP-seq
MIRT1350216	hsa-miR-4784	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT2459420	hsa-miR-4520a-3p	CLIP-seq
MIRT2459421	hsa-miR-4520b-3p	CLIP-seq
MIRT2459422	hsa-miR-4529-3p	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT2459423	hsa-miR-494	CLIP-seq
MIRT1350162	hsa-miR-1225-5p	CLIP-seq
MIRT2327877	hsa-miR-127-5p	CLIP-seq
MIRT2622879	hsa-miR-1291	CLIP-seq
MIRT2327878	hsa-miR-1293	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT2622880	hsa-miR-2861	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT2622881	hsa-miR-3127-5p	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT2327879	hsa-miR-3165	CLIP-seq
MIRT2622882	hsa-miR-328	CLIP-seq
MIRT2327883	hsa-miR-3614-5p	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT2622883	hsa-miR-3918	CLIP-seq
MIRT2622884	hsa-miR-4446-3p	CLIP-seq
MIRT2327890	hsa-miR-4483	CLIP-seq
MIRT2622885	hsa-miR-4492	CLIP-seq
MIRT2622886	hsa-miR-4498	CLIP-seq
MIRT2103741	hsa-miR-4501	CLIP-seq
MIRT2622887	hsa-miR-4505	CLIP-seq
MIRT2459421	hsa-miR-4520b-3p	CLIP-seq
MIRT2459422	hsa-miR-4529-3p	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT2622888	hsa-miR-4651	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT2622889	hsa-miR-4732-3p	CLIP-seq
MIRT2327897	hsa-miR-4786-3p	CLIP-seq
MIRT2622890	hsa-miR-4792	CLIP-seq
MIRT2459423	hsa-miR-494	CLIP-seq
MIRT2622891	hsa-miR-608	CLIP-seq
MIRT1350229	hsa-miR-661	CLIP-seq
MIRT2622892	hsa-miR-663b	CLIP-seq
MIRT2622893	hsa-miR-762	CLIP-seq
MIRT2327877	hsa-miR-127-5p	CLIP-seq
MIRT2327878	hsa-miR-1293	CLIP-seq
MIRT1350235	hsa-miR-186	CLIP-seq
MIRT1350237	hsa-miR-203	CLIP-seq
MIRT1350178	hsa-miR-3122	CLIP-seq
MIRT1350239	hsa-miR-3133	CLIP-seq
MIRT2327879	hsa-miR-3165	CLIP-seq
MIRT2327883	hsa-miR-3614-5p	CLIP-seq
MIRT1350184	hsa-miR-3689a-3p	CLIP-seq
MIRT1350185	hsa-miR-3689c	CLIP-seq
MIRT1350189	hsa-miR-3913-5p	CLIP-seq
MIRT2327886	hsa-miR-3926	CLIP-seq
MIRT2327890	hsa-miR-4483	CLIP-seq
MIRT1350241	hsa-miR-4635	CLIP-seq
MIRT1350211	hsa-miR-4728-5p	CLIP-seq
MIRT2327897	hsa-miR-4786-3p	CLIP-seq
MIRT2327898	hsa-miR-4786-5p	CLIP-seq
MIRT2459423	hsa-miR-494	CLIP-seq
MIRT2327899	hsa-miR-548p	CLIP-seq
MIRT2327900	hsa-miR-548s	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003950	Function	NAD+ ADP-ribosyltransferase activity	TAS	17456799
GO:0005515	Function	Protein binding	IPI	16788062, 19343720, 19535340, 22770219, 23283301, 24344202, 29445193, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005739	Component	Mitochondrion	IDA	16079181
GO:0005759	Component	Mitochondrial matrix	IDA	12186850, 29445193
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006471	Process	Protein ADP-ribosylation	ISS	10381378
GO:0006471	Process	Protein ADP-ribosylation	TAS	17456799
GO:0006476	Process	Protein deacetylation	IDA	16788062
GO:0007005	Process	Mitochondrion organization	TAS
GO:0007568	Process	Aging	IEA
GO:0008270	Function	Zinc ion binding	IDA	19535340
GO:0009060	Process	Aerobic respiration	IMP	22309213
GO:0016575	Process	Histone deacetylation	IEA
GO:0017136	Function	NAD-dependent histone deacetylase activity	IBA	21873635
GO:0019899	Function	Enzyme binding	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032991	Component	Protein-containing complex	IDA	23283301, 29445193
GO:0034979	Function	NAD-dependent protein deacetylase activity	ISS
GO:0034983	Process	Peptidyl-lysine deacetylation	IMP	22309213
GO:0034983	Process	Peptidyl-lysine deacetylation	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	29445193
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070403	Function	NAD+ binding	IBA	21873635
GO:1901671	Process	Positive regulation of superoxide dismutase activity	IDA	25210848
GO:1902553	Process	Positive regulation of catalase activity	IDA	25210848
GO:2000304	Process	Positive regulation of ceramide biosynthetic process	ISS
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
604481	14931	ENSG00000142082

Protein

UniProt ID

Q9NTG7

Protein name

NAD-dependent protein deacetylase sirtuin-3, mitochondrial (hSIRT3) (EC 2.3.1.286) (NAD-dependent protein delactylase sirtuin-3) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 3) (SIR2-like protein 3)

Protein function

NAD-dependent protein deacetylase (PubMed:12186850, PubMed:12374852, PubMed:16788062, PubMed:18680753, PubMed:18794531, PubMed:19535340, PubMed:23283301, PubMed:24121500, PubMed:24252090). Activates or deactivates mitochondrial target proteins b

PDB

3GLR , 3GLS , 3GLT , 3GLU , 4BN4 , 4BN5 , 4BV3 , 4BVB , 4BVE , 4BVF , 4BVG , 4BVH , 4C78 , 4C7B , 4FVT , 4FZ3 , 4HD8 , 4JSR , 4JT8 , 4JT9 , 4O8Z , 5BWN , 5BWO , 5D7N , 5H4D , 5Y4H , 5YTK , 5Z93 , 5Z94 , 5ZGC , 6ISO , 8ANC , 8BBK , 8CCW , 8CCZ , 8HLW , 8HLY , 8HN9 , 8V15 , 8V2N , 8V5U , 9CBT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02146	SIR2	145 → 326	Sir2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378, ECO:0000269|PubMed:12374852}.

Sequence

MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Sequence length

399

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Central carbon metabolism in cancer		Transcriptional activation of mitochondrial biogenesis FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes Regulation of FOXO transcriptional activity by acetylation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	21472714
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	23956348

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Uterine Fibroids	Uterine Fibroids	GWAS
Coronary artery disease	Coronary artery disease	GWAS
Cerebral Aneurysm	Cerebral Aneurysm	GWAS
Intracranial Aneurysm	Intracranial Aneurysm	GWAS
Hypothyroidism	Hypothyroidism	GWAS

Show/Hide Text Mining Associations (129)

Disease Name	Relationship Type	References
Associations from Text Mining
Aging Premature	Associate	38004107
Alzheimer Disease	Associate	31370365
Alzheimer Disease	Inhibit	32104538, 32747616
Amyotrophic Lateral Sclerosis	Inhibit	28239025
Amyotrophic Lateral Sclerosis	Associate	28239025
Anodontia	Inhibit	36991356
Arthritis Rheumatoid	Associate	33530998
Ascites	Associate	31723239
Atherosclerosis	Associate	35791925
Brain Neoplasms	Associate	23612572
Breast Neoplasms	Stimulate	17003781
Breast Neoplasms	Associate	23598413, 24746213, 25556440, 25562154, 27165221, 27270321, 29915029, 36974538
Breast Neoplasms	Inhibit	24448804
Carcinogenesis	Associate	22674009, 23272146, 23800187, 30715550, 34232204
Carcinoma Basal Cell	Inhibit	26631040
Carcinoma Hepatocellular	Associate	23272146, 23790338, 24774224, 27367026, 28338198, 28985579, 30917505, 32306906, 36308411, 38548246
Carcinoma Hepatocellular	Inhibit	28347248
Carcinoma Non Small Cell Lung	Associate	24042441, 27501149, 28947845, 33819917
Carcinoma Pancreatic Ductal	Associate	35392973
Carcinoma Renal Cell	Associate	25755722, 37996927
Carcinoma Renal Cell	Stimulate	37096064
Cardiomyopathy Dilated	Associate	33303703
Carotid Artery Diseases	Associate	36083252
Cerebral Infarction	Associate	28965081, 36012382
Colorectal Neoplasms	Associate	25105144, 31188638, 32312920, 32811824, 34747319, 35122251, 35440893, 36594098, 36871142, 37789393, 39291655
Communication Disorders	Inhibit	34397875
Coronary Artery Disease	Associate	35224092
Coronary Artery Disease	Inhibit	35791925
Deafness Cataract Retinitis Pigmentosa And Sperm Abnormalities	Associate	36142505
Death	Associate	35452193
Dental Plaque	Associate	36083252
Diabetes Mellitus	Inhibit	25755722
Diabetes Mellitus	Associate	30736780, 36010644
Diabetes Mellitus	Stimulate	30917505, 32377289
Diabetes Mellitus Type 1	Inhibit	30736780, 35409099
Diabetes Mellitus Type 2	Inhibit	30736780, 35409099, 35791925
Diabetes Mellitus Type 2	Associate	33191653
Diabetic Angiopathies	Associate	38175638
Diabetic Foot	Associate	33096729
Diabetic Nephropathies	Associate	34278469
Diabetic Retinopathy	Associate	33423553, 38175638
Drug Related Side Effects and Adverse Reactions	Associate	25755722, 32486166
Dyslipidemias	Associate	26332421
Endometrial Neoplasms	Associate	26701732
Endometriosis	Associate	35980861
Fetal Growth Retardation	Stimulate	30941904
Fibrocartilaginous embolism	Associate	36890588
Glioma	Associate	27270321, 28567457, 36809279
Granulosa Cell Tumor	Associate	33669567
Heart Diseases	Associate	25755722, 38330708
Hyperglycemia	Associate	38175638
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	35791925
Hypertension Pulmonary	Associate	29070699
Hypothyroidism	Inhibit	30736780
Hypoxia	Associate	27270321, 35042949
Inflammation	Associate	26114387, 28161061, 32289749, 35832490, 36010644, 36083252
Inflammation	Inhibit	33062145
Insulin Resistance	Associate	35409099
Ischemia	Associate	28965081, 36012382, 36193071, 38052275
Leiomyoma	Inhibit	39736018
Leukemia	Associate	32486166
Leukemia Biphenotypic Acute	Associate	36439178
Leukemia Lymphocytic Chronic B Cell	Associate	23108383, 34001853
Leukemia Lymphocytic Chronic B Cell	Inhibit	26631723
Leukemia Myeloid Acute	Associate	37021547
Li Fraumeni Syndrome	Associate	23612572
Lung Diseases	Associate	35042949
Lung Neoplasms	Associate	24042441
Lung Neoplasms	Inhibit	34232204
Lymphatic Metastasis	Associate	25105144, 25562154, 28947845, 34232204
Lymphoma B Cell	Inhibit	26631723
Lymphoma Large B Cell Diffuse	Associate	33273545, 35019856
Macular dystrophy retinal 1 North Carolina type	Inhibit	33423553
Malformations of Cortical Development Group I	Associate	38052275
Mammary Neoplasms Animal	Associate	24746213
Melanoma	Associate	31292999
Metabolic Diseases	Associate	26275361, 28985579, 30656603, 30917505
Mitochondrial Diseases	Associate	23046812, 23598413, 23868064, 24324009, 25522270, 27501149, 31037127, 31188638, 32104538, 32863233, 35297042, 35832490, 36871142, 36964505, 37447299, 37795870 View all (1 more)
Mitochondrial Diseases	Stimulate	23108666
Mitochondrial Diseases	Inhibit	30656603, 38548246
Mouth Neoplasms	Associate	23800187
Movement Disorders	Associate	29081897
Muscular Atrophy	Associate	38004107
Myocardial Ischemia	Associate	36991356
N syndrome	Associate	36142505
Neoplasm Metastasis	Associate	28368421, 31723239, 34232204
Neoplasm Metastasis	Inhibit	29915029
Neoplasm Metastasis	Stimulate	33282964
Neoplasms	Associate	22674009, 23790338, 23800187, 23868064, 24042441, 25105144, 25152236, 25562154, 27270321, 27367026, 28582846, 29064820, 30656603, 30917505, 32863233 View all (11 more)
Neoplasms	Inhibit	23108666, 24324009, 24746213, 24774224, 26121130, 26631040, 26631723, 26785117, 28338198, 28985579, 31723239, 32306906, 32846968
Neurotoxicity Syndromes	Associate	32741912
Nevus Pigmented	Associate	31037127
Non alcoholic Fatty Liver Disease	Associate	34446002
Obesity	Associate	33185172, 35409099
Oligospermia	Associate	36142505
Ophthalmoplegia Chronic Progressive External	Associate	23046812
Optic Nerve Diseases	Associate	36964505
Osteoarthritis	Associate	33062145, 34646424
Osteogenesis Imperfecta	Associate	32141579
Osteoglophonic dwarfism	Inhibit	36012382
Osteoporosis	Associate	33662874
Ovarian Neoplasms	Associate	31113446, 31723239, 32495859
Ovarian Neoplasms	Inhibit	32541517
Pancreatic Neoplasms	Inhibit	26121130
Pancreatic Neoplasms	Associate	30487699, 36200682
Personality Disorders	Associate	32681437
Porphyria Variegate	Associate	20331452
Pre Eclampsia	Associate	28161061
Prostatic Neoplasms	Associate	33282964
Pulmonary Arterial Hypertension	Associate	33143333, 35042949
Rectal Neoplasms	Associate	36871142
Reperfusion Injury	Inhibit	33241954, 38330708
Reperfusion Injury	Associate	36991356, 38012584, 38052275
Ring Chromosome 20 Syndrome	Inhibit	36991356
Seminoma	Associate	28459202
Sleep Deprivation	Inhibit	29072685
Sleep Deprivation	Associate	29549422
Squamous Cell Carcinoma of Head and Neck	Associate	22674009, 23475622, 23800187, 26785117, 40009568
Teratozoospermia	Inhibit	36142505
Thrombosis	Associate	23790338
Thyroid Neoplasms	Associate	35136826
Tongue Neoplasms	Associate	30656603
Triple Negative Breast Neoplasms	Associate	32681437
Uveal melanoma	Associate	37362244
Vascular Diseases	Associate	35791925
Visceral myopathy familial external ophthalmoplegia	Associate	23868064
Vitiligo	Associate	31037127
Wounds and Injuries	Associate	29072685
Wounds and Injuries	Inhibit	36991356

SIRT3 (sirtuin 3)