Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23410
Gene name Gene Name - the full gene name approved by the HGNC.
Sirtuin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SIRT3
Synonyms (NCBI Gene) Gene synonyms aliases
SIR2L3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent th
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT732205 hsa-miR-421 Luciferase reporter assay 27107702
MIRT732205 hsa-miR-421 Luciferase reporter assay 27107702
MIRT734872 hsa-miR-505-3p Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunocytochemistry (ICC) 33385630
MIRT734872 hsa-miR-505-3p Luciferase reporter assay, Western blotting, qRT-PCR 34646424
MIRT1350159 hsa-miR-1 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003950 Function NAD+ poly-ADP-ribosyltransferase activity TAS 17456799
GO:0005515 Function Protein binding IPI 16788062, 19343720, 19535340, 22770219, 23283301, 24344202, 29445193, 32814053
GO:0005634 Component Nucleus IBA
GO:0005654 Component Nucleoplasm TAS
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604481 14931 ENSG00000142082
Protein
UniProt ID Q9NTG7
Protein name NAD-dependent protein deacetylase sirtuin-3, mitochondrial (hSIRT3) (EC 2.3.1.286) (NAD-dependent protein delactylase sirtuin-3) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 3) (SIR2-like protein 3)
Protein function NAD-dependent protein deacetylase (PubMed:12186850, PubMed:12374852, PubMed:16788062, PubMed:18680753, PubMed:18794531, PubMed:19535340, PubMed:23283301, PubMed:24121500, PubMed:24252090). Activates or deactivates mitochondrial target proteins b
PDB 3GLR , 3GLS , 3GLT , 3GLU , 4BN4 , 4BN5 , 4BV3 , 4BVB , 4BVE , 4BVF , 4BVG , 4BVH , 4C78 , 4C7B , 4FVT , 4FZ3 , 4HD8 , 4JSR , 4JT8 , 4JT9 , 4O8Z , 5BWN , 5BWO , 5D7N , 5H4D , 5Y4H , 5YTK , 5Z93 , 5Z94 , 5ZGC , 6ISO , 8ANC , 8BBK , 8CCW , 8CCZ , 8HLW , 8HLY , 8HN9 , 8V15 , 8V2N , 8V5U , 9CBT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02146 SIR2 145 326 Sir2 family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378, ECO:0000269|PubMed:12374852}.
Sequence
MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEP
FASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Sequence length 399
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Nicotinate and nicotinamide metabolism
Metabolic pathways
Central carbon metabolism in cancer
  Transcriptional activation of mitochondrial biogenesis
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Regulation of FOXO transcriptional activity by acetylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cerebral Aneurysm Cerebral aneurysm N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aging Premature Associate 38004107
Alzheimer Disease Associate 31370365
Alzheimer Disease Inhibit 32104538, 32747616
Amyotrophic Lateral Sclerosis Inhibit 28239025
Amyotrophic Lateral Sclerosis Associate 28239025
Anodontia Inhibit 36991356
Arthritis Rheumatoid Associate 33530998
Ascites Associate 31723239
Atherosclerosis Associate 35791925
Brain Neoplasms Associate 23612572