Gene Gene information from NCBI Gene database.
Entrez ID 23396
Gene name Phosphatidylinositol-4-phosphate 5-kinase type 1 gamma
Gene symbol PIP5K1C
Synonyms (NCBI Gene)
LCCS3PIP5K-GAMMAPIP5K1-gammaPIP5Kgamma
Chromosome 19
Chromosome location 19p13.3
Summary This locus encodes a type I phosphatidylinositol 4-phosphate 5-kinase. The encoded protein catalyzes phosphorylation of phosphatidylinositol 4-phosphate, producing phosphatidylinositol 4,5-bisphosphate. This enzyme is found at synapses and has been found
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs121908315 C>T Pathogenic Coding sequence variant, genic upstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
393
miRTarBase ID miRNA Experiments Reference
MIRT027379 hsa-miR-101-3p Sequencing 20371350
MIRT028353 hsa-miR-32-5p Sequencing 20371350
MIRT030015 hsa-miR-26b-5p Microarray 19088304
MIRT041364 hsa-miR-193b-3p CLASH 23622248
MIRT723217 hsa-miR-1197 HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
EZH2 Repression 21216957
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001891 Component Phagocytic cup IEA
GO:0001931 Component Uropod IEA
GO:0001931 Component Uropod TAS 19889969
GO:0005515 Function Protein binding IPI 23982733, 25588945, 35044719
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606102 8996 ENSG00000186111
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60331
Protein name Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma (PIP5K1gamma) (PtdIns(4)P-5-kinase 1 gamma) (EC 2.7.1.68) (Type I phosphatidylinositol 4-phosphate 5-kinase gamma)
Protein function Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns(4)P/PI4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2/PIP2), a lipid second messenger that regulates several cellular processes such as signal transductio
PDB 2G35 , 3H1Z , 3H85
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01504 PIP5K 160 442 Phosphatidylinositol-4-phosphate 5-Kinase Family
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: Isoform 1 is strongly expressed in brain and also detected in heart and lung. {ECO:0000269|PubMed:19548880}.; TISSUE SPECIFICITY: [Isoform 2]: Isoform 2 is strongly expressed in pancreas and liver and in lesser quantities
Sequence
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNT
VFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPP
ASDGESDT
Sequence length 668
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Endocytosis
Focal adhesion
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Yersinia infection
Choline metabolism in cancer
  Synthesis of PIPs at the plasma membrane
SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Clathrin-mediated endocytosis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
38
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lethal congenital contracture syndrome 3 Pathogenic rs121908315 RCV000004878
PIP5K1C-related neurodevelopmental disorder Pathogenic rs991616868 RCV004527278
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Likely benign; Benign rs45455692, rs1879037 RCV005917528
RCV005921795
Clear cell carcinoma of kidney Benign rs1879037 RCV005921798
Familial cancer of breast Likely benign; Benign rs45455692, rs1004323 RCV005917527
RCV005921616
Hepatocellular carcinoma Benign rs1879037 RCV005921796
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 37010714
Adenocarcinoma of Lung Associate 26840709
Alzheimer Disease Associate 37010714
Arthrogryposis Associate 17701898
Carcinogenesis Associate 37010714
Lethal Congenital Contractural Syndrome 3 Associate 17701898
Lethal Congenital Contracture Syndrome 2 Associate 17701898
Leukemia Myeloid Acute Associate 36175877
Neoplasm Metastasis Associate 30040488, 37010714
Neoplasms Associate 36803256