Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23394
Gene name Gene Name - the full gene name approved by the HGNC.	Activity dependent neuroprotector homeobox
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADNP
Synonyms (NCBI Gene) Gene synonyms aliases	ADNP1, HVDAS, MRD28
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be invol

Show/Hide all(47)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777522	AATT>-	Pathogenic	Coding sequence variant, frameshift variant
rs587777523	TTTA>-	Pathogenic	Coding sequence variant, frameshift variant
rs587777524	G>A,C,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs587777525	G>-	Pathogenic	Coding sequence variant, stop gained
rs587777526	G>A,C,T	Likely-benign, pathogenic, likely-pathogenic	Coding sequence variant, stop gained, synonymous variant
rs779340209	G>C	Pathogenic	Coding sequence variant, stop gained
rs886039649	GTA>ACAG	Pathogenic	Coding sequence variant, frameshift variant
rs886041116	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, stop gained
rs886041449	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs886041498	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs886041722	G>A	Pathogenic	Coding sequence variant, stop gained
rs886041741	->T	Pathogenic	Coding sequence variant, frameshift variant
rs886042001	A>C	Pathogenic	Coding sequence variant, stop gained
rs886042003	->G	Pathogenic	Coding sequence variant, frameshift variant
rs886042026	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1057518345	ACTA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057518978	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1057518991	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1064793677	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064796339	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064796656	C>G,T	Uncertain-significance, pathogenic	Splice acceptor variant
rs1131691281	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1131691770	A>-	Pathogenic	Stop gained, coding sequence variant
rs1135401791	G>A	Pathogenic	Stop gained, coding sequence variant
rs1135401808	->T	Pathogenic-likely-pathogenic, pathogenic	Stop gained, coding sequence variant
rs1555809337	->A	Likely-pathogenic	Terminator codon variant, stop lost, frameshift variant
rs1555809836	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555809919	A>-,AA	Pathogenic	Coding sequence variant, frameshift variant
rs1555809953	C>A	Pathogenic	Stop gained, coding sequence variant
rs1555809957	C>A	Pathogenic	Stop gained, coding sequence variant
rs1555809984	AACT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555809987	->T	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555810001	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555810093	TTGAAAAGCAAAGAGGA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555810163	->T	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555810193	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555810308	C>T	Pathogenic	Stop gained, coding sequence variant
rs1555810335	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1555810376	TT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555810401	GG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555810794	GGTA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555812474	->C	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1600930118	CGT>-	Pathogenic	Stop gained, coding sequence variant, inframe indel
rs1600930164	G>-	Likely-pathogenic	Stop gained, coding sequence variant
rs1600932676	->C	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1600934347	G>A	Pathogenic	Stop gained, coding sequence variant
rs1600956591	CA>-	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(431)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025421	hsa-miR-34a-5p	Proteomics	21566225
MIRT025421	hsa-miR-34a-5p	Proteomics	21566225
MIRT029262	hsa-miR-26b-5p	Microarray	19088304
MIRT030862	hsa-miR-21-5p	Microarray	18591254
MIRT052249	hsa-let-7b-5p	CLASH	23622248
MIRT043763	hsa-miR-328-3p	CLASH	23622248
MIRT769366	hsa-miR-1226	CLIP-seq
MIRT769367	hsa-miR-1243	CLIP-seq
MIRT769368	hsa-miR-1253	CLIP-seq
MIRT769369	hsa-miR-1264	CLIP-seq
MIRT769370	hsa-miR-1284	CLIP-seq
MIRT769371	hsa-miR-141	CLIP-seq
MIRT769372	hsa-miR-151-3p	CLIP-seq
MIRT769373	hsa-miR-154	CLIP-seq
MIRT769374	hsa-miR-194	CLIP-seq
MIRT769375	hsa-miR-198	CLIP-seq
MIRT769376	hsa-miR-19a	CLIP-seq
MIRT769377	hsa-miR-19b	CLIP-seq
MIRT769378	hsa-miR-200a	CLIP-seq
MIRT769379	hsa-miR-2052	CLIP-seq
MIRT769380	hsa-miR-21	CLIP-seq
MIRT769381	hsa-miR-22	CLIP-seq
MIRT769382	hsa-miR-23a	CLIP-seq
MIRT769383	hsa-miR-23b	CLIP-seq
MIRT769384	hsa-miR-23c	CLIP-seq
MIRT769385	hsa-miR-2682	CLIP-seq
MIRT769386	hsa-miR-27a	CLIP-seq
MIRT769387	hsa-miR-27b	CLIP-seq
MIRT769388	hsa-miR-28-3p	CLIP-seq
MIRT769389	hsa-miR-300	CLIP-seq
MIRT769390	hsa-miR-3074-3p	CLIP-seq
MIRT769391	hsa-miR-3120-3p	CLIP-seq
MIRT769392	hsa-miR-3140-3p	CLIP-seq
MIRT769393	hsa-miR-3153	CLIP-seq
MIRT769394	hsa-miR-3201	CLIP-seq
MIRT769395	hsa-miR-3607-5p	CLIP-seq
MIRT769396	hsa-miR-3614-5p	CLIP-seq
MIRT769397	hsa-miR-361-5p	CLIP-seq
MIRT769398	hsa-miR-3617	CLIP-seq
MIRT769399	hsa-miR-369-3p	CLIP-seq
MIRT769400	hsa-miR-3714	CLIP-seq
MIRT769401	hsa-miR-371-5p	CLIP-seq
MIRT769402	hsa-miR-371b-5p	CLIP-seq
MIRT769403	hsa-miR-374a	CLIP-seq
MIRT769404	hsa-miR-374b	CLIP-seq
MIRT769405	hsa-miR-374c	CLIP-seq
MIRT769406	hsa-miR-381	CLIP-seq
MIRT769407	hsa-miR-3941	CLIP-seq
MIRT769408	hsa-miR-3942-3p	CLIP-seq
MIRT769409	hsa-miR-409-3p	CLIP-seq
MIRT769410	hsa-miR-421	CLIP-seq
MIRT769411	hsa-miR-4256	CLIP-seq
MIRT769412	hsa-miR-4302	CLIP-seq
MIRT769413	hsa-miR-4315	CLIP-seq
MIRT769414	hsa-miR-4328	CLIP-seq
MIRT769415	hsa-miR-433	CLIP-seq
MIRT769416	hsa-miR-4446-5p	CLIP-seq
MIRT769417	hsa-miR-4457	CLIP-seq
MIRT769418	hsa-miR-4463	CLIP-seq
MIRT769419	hsa-miR-4499	CLIP-seq
MIRT769420	hsa-miR-449c	CLIP-seq
MIRT769421	hsa-miR-4503	CLIP-seq
MIRT769422	hsa-miR-455-5p	CLIP-seq
MIRT769423	hsa-miR-4643	CLIP-seq
MIRT769424	hsa-miR-4645-5p	CLIP-seq
MIRT769425	hsa-miR-466	CLIP-seq
MIRT769426	hsa-miR-4661-5p	CLIP-seq
MIRT769427	hsa-miR-4672	CLIP-seq
MIRT769428	hsa-miR-4673	CLIP-seq
MIRT769429	hsa-miR-4704-3p	CLIP-seq
MIRT769430	hsa-miR-4709-5p	CLIP-seq
MIRT769431	hsa-miR-4719	CLIP-seq
MIRT769432	hsa-miR-4733-3p	CLIP-seq
MIRT769433	hsa-miR-4760-5p	CLIP-seq
MIRT769434	hsa-miR-4766-5p	CLIP-seq
MIRT769435	hsa-miR-4789-3p	CLIP-seq
MIRT769436	hsa-miR-4789-5p	CLIP-seq
MIRT769437	hsa-miR-4790-5p	CLIP-seq
MIRT769438	hsa-miR-4791	CLIP-seq
MIRT769439	hsa-miR-490-3p	CLIP-seq
MIRT769440	hsa-miR-5096	CLIP-seq
MIRT769441	hsa-miR-513a-5p	CLIP-seq
MIRT769442	hsa-miR-513b	CLIP-seq
MIRT769443	hsa-miR-513c	CLIP-seq
MIRT769444	hsa-miR-514b-5p	CLIP-seq
MIRT769445	hsa-miR-518a-5p	CLIP-seq
MIRT769446	hsa-miR-527	CLIP-seq
MIRT769447	hsa-miR-548ae	CLIP-seq
MIRT769448	hsa-miR-548aj	CLIP-seq
MIRT769449	hsa-miR-548am	CLIP-seq
MIRT769450	hsa-miR-548an	CLIP-seq
MIRT769451	hsa-miR-548c-3p	CLIP-seq
MIRT769452	hsa-miR-548u	CLIP-seq
MIRT769453	hsa-miR-548x	CLIP-seq
MIRT769454	hsa-miR-556-3p	CLIP-seq
MIRT769455	hsa-miR-570	CLIP-seq
MIRT769456	hsa-miR-590-5p	CLIP-seq
MIRT769457	hsa-miR-592	CLIP-seq
MIRT769458	hsa-miR-597	CLIP-seq
MIRT769459	hsa-miR-603	CLIP-seq
MIRT769460	hsa-miR-624	CLIP-seq
MIRT769461	hsa-miR-630	CLIP-seq
MIRT769462	hsa-miR-641	CLIP-seq
MIRT769463	hsa-miR-653	CLIP-seq
MIRT769464	hsa-miR-655	CLIP-seq
MIRT769465	hsa-miR-656	CLIP-seq
MIRT769466	hsa-miR-664	CLIP-seq
MIRT769467	hsa-miR-759	CLIP-seq
MIRT769468	hsa-miR-802	CLIP-seq
MIRT769469	hsa-miR-934	CLIP-seq
MIRT769366	hsa-miR-1226	CLIP-seq
MIRT769470	hsa-miR-1238	CLIP-seq
MIRT769368	hsa-miR-1253	CLIP-seq
MIRT769380	hsa-miR-21	CLIP-seq
MIRT769381	hsa-miR-22	CLIP-seq
MIRT769385	hsa-miR-2682	CLIP-seq
MIRT769392	hsa-miR-3140-3p	CLIP-seq
MIRT769471	hsa-miR-3163	CLIP-seq
MIRT769472	hsa-miR-3646	CLIP-seq
MIRT769473	hsa-miR-3662	CLIP-seq
MIRT769400	hsa-miR-3714	CLIP-seq
MIRT769415	hsa-miR-433	CLIP-seq
MIRT769417	hsa-miR-4457	CLIP-seq
MIRT769420	hsa-miR-449c	CLIP-seq
MIRT769474	hsa-miR-4668-5p	CLIP-seq
MIRT769475	hsa-miR-4698	CLIP-seq
MIRT769431	hsa-miR-4719	CLIP-seq
MIRT769432	hsa-miR-4733-3p	CLIP-seq
MIRT769436	hsa-miR-4789-5p	CLIP-seq
MIRT769440	hsa-miR-5096	CLIP-seq
MIRT769442	hsa-miR-513b	CLIP-seq
MIRT769445	hsa-miR-518a-5p	CLIP-seq
MIRT769476	hsa-miR-520d-5p	CLIP-seq
MIRT769477	hsa-miR-524-5p	CLIP-seq
MIRT769446	hsa-miR-527	CLIP-seq
MIRT769478	hsa-miR-577	CLIP-seq
MIRT769456	hsa-miR-590-5p	CLIP-seq
MIRT769461	hsa-miR-630	CLIP-seq
MIRT769466	hsa-miR-664	CLIP-seq
MIRT1926951	hsa-miR-103a	CLIP-seq
MIRT1926952	hsa-miR-107	CLIP-seq
MIRT1926953	hsa-miR-1184	CLIP-seq
MIRT769366	hsa-miR-1226	CLIP-seq
MIRT769367	hsa-miR-1243	CLIP-seq
MIRT769368	hsa-miR-1253	CLIP-seq
MIRT1926954	hsa-miR-1257	CLIP-seq
MIRT769369	hsa-miR-1264	CLIP-seq
MIRT1926955	hsa-miR-1267	CLIP-seq
MIRT1926956	hsa-miR-1272	CLIP-seq
MIRT769370	hsa-miR-1284	CLIP-seq
MIRT1926957	hsa-miR-1291	CLIP-seq
MIRT1926958	hsa-miR-1305	CLIP-seq
MIRT1926959	hsa-miR-1322	CLIP-seq
MIRT769371	hsa-miR-141	CLIP-seq
MIRT769372	hsa-miR-151-3p	CLIP-seq
MIRT1926960	hsa-miR-187	CLIP-seq
MIRT769374	hsa-miR-194	CLIP-seq
MIRT769375	hsa-miR-198	CLIP-seq
MIRT769376	hsa-miR-19a	CLIP-seq
MIRT769377	hsa-miR-19b	CLIP-seq
MIRT769378	hsa-miR-200a	CLIP-seq
MIRT769379	hsa-miR-2052	CLIP-seq
MIRT769380	hsa-miR-21	CLIP-seq
MIRT1926961	hsa-miR-2277-3p	CLIP-seq
MIRT769382	hsa-miR-23a	CLIP-seq
MIRT769383	hsa-miR-23b	CLIP-seq
MIRT769384	hsa-miR-23c	CLIP-seq
MIRT769385	hsa-miR-2682	CLIP-seq
MIRT769386	hsa-miR-27a	CLIP-seq
MIRT769387	hsa-miR-27b	CLIP-seq
MIRT1926962	hsa-miR-297	CLIP-seq
MIRT769389	hsa-miR-300	CLIP-seq
MIRT769390	hsa-miR-3074-3p	CLIP-seq
MIRT769391	hsa-miR-3120-3p	CLIP-seq
MIRT769392	hsa-miR-3140-3p	CLIP-seq
MIRT1926963	hsa-miR-3149	CLIP-seq
MIRT769393	hsa-miR-3153	CLIP-seq
MIRT769471	hsa-miR-3163	CLIP-seq
MIRT1926964	hsa-miR-3176	CLIP-seq
MIRT1926965	hsa-miR-3189-5p	CLIP-seq
MIRT769394	hsa-miR-3201	CLIP-seq
MIRT1926966	hsa-miR-328	CLIP-seq
MIRT1926967	hsa-miR-3545-3p	CLIP-seq
MIRT769395	hsa-miR-3607-5p	CLIP-seq
MIRT769396	hsa-miR-3614-5p	CLIP-seq
MIRT769397	hsa-miR-361-5p	CLIP-seq
MIRT769398	hsa-miR-3617	CLIP-seq
MIRT1926968	hsa-miR-3652	CLIP-seq
MIRT1926969	hsa-miR-3680	CLIP-seq
MIRT769400	hsa-miR-3714	CLIP-seq
MIRT769401	hsa-miR-371-5p	CLIP-seq
MIRT769402	hsa-miR-371b-5p	CLIP-seq
MIRT769405	hsa-miR-374c	CLIP-seq
MIRT1926970	hsa-miR-376a	CLIP-seq
MIRT1926971	hsa-miR-376b	CLIP-seq
MIRT769406	hsa-miR-381	CLIP-seq
MIRT1926972	hsa-miR-3919	CLIP-seq
MIRT1926973	hsa-miR-3922-3p	CLIP-seq
MIRT769407	hsa-miR-3941	CLIP-seq
MIRT769409	hsa-miR-409-3p	CLIP-seq
MIRT769411	hsa-miR-4256	CLIP-seq
MIRT769412	hsa-miR-4302	CLIP-seq
MIRT769413	hsa-miR-4315	CLIP-seq
MIRT769414	hsa-miR-4328	CLIP-seq
MIRT769415	hsa-miR-433	CLIP-seq
MIRT1926974	hsa-miR-4418	CLIP-seq
MIRT1926975	hsa-miR-4421	CLIP-seq
MIRT1926976	hsa-miR-4430	CLIP-seq
MIRT769416	hsa-miR-4446-5p	CLIP-seq
MIRT1926977	hsa-miR-4453	CLIP-seq
MIRT769417	hsa-miR-4457	CLIP-seq
MIRT769418	hsa-miR-4463	CLIP-seq
MIRT769419	hsa-miR-4499	CLIP-seq
MIRT769420	hsa-miR-449c	CLIP-seq
MIRT769421	hsa-miR-4503	CLIP-seq
MIRT1926978	hsa-miR-4505	CLIP-seq
MIRT1926979	hsa-miR-451b	CLIP-seq
MIRT1926980	hsa-miR-4538	CLIP-seq
MIRT1926981	hsa-miR-455-3p	CLIP-seq
MIRT769422	hsa-miR-455-5p	CLIP-seq
MIRT769423	hsa-miR-4643	CLIP-seq
MIRT769424	hsa-miR-4645-5p	CLIP-seq
MIRT769425	hsa-miR-466	CLIP-seq
MIRT769426	hsa-miR-4661-5p	CLIP-seq
MIRT769427	hsa-miR-4672	CLIP-seq
MIRT769428	hsa-miR-4673	CLIP-seq
MIRT1926982	hsa-miR-4684-3p	CLIP-seq
MIRT1926983	hsa-miR-4694-5p	CLIP-seq
MIRT1926984	hsa-miR-4696	CLIP-seq
MIRT769475	hsa-miR-4698	CLIP-seq
MIRT769429	hsa-miR-4704-3p	CLIP-seq
MIRT1926985	hsa-miR-4704-5p	CLIP-seq
MIRT769430	hsa-miR-4709-5p	CLIP-seq
MIRT1926986	hsa-miR-4712-5p	CLIP-seq
MIRT769432	hsa-miR-4733-3p	CLIP-seq
MIRT1926987	hsa-miR-4744	CLIP-seq
MIRT1926988	hsa-miR-4756-3p	CLIP-seq
MIRT1926989	hsa-miR-4757-5p	CLIP-seq
MIRT1926990	hsa-miR-4758-3p	CLIP-seq
MIRT769433	hsa-miR-4760-5p	CLIP-seq
MIRT1926991	hsa-miR-4773	CLIP-seq
MIRT1926992	hsa-miR-4781-3p	CLIP-seq
MIRT769435	hsa-miR-4789-3p	CLIP-seq
MIRT769436	hsa-miR-4789-5p	CLIP-seq
MIRT769437	hsa-miR-4790-5p	CLIP-seq
MIRT769438	hsa-miR-4791	CLIP-seq
MIRT1926993	hsa-miR-4798-3p	CLIP-seq
MIRT769439	hsa-miR-490-3p	CLIP-seq
MIRT1926994	hsa-miR-509-3-5p	CLIP-seq
MIRT1926995	hsa-miR-509-5p	CLIP-seq
MIRT769440	hsa-miR-5096	CLIP-seq
MIRT769441	hsa-miR-513a-5p	CLIP-seq
MIRT769442	hsa-miR-513b	CLIP-seq
MIRT769443	hsa-miR-513c	CLIP-seq
MIRT769444	hsa-miR-514b-5p	CLIP-seq
MIRT769447	hsa-miR-548ae	CLIP-seq
MIRT769448	hsa-miR-548aj	CLIP-seq
MIRT769449	hsa-miR-548am	CLIP-seq
MIRT769450	hsa-miR-548an	CLIP-seq
MIRT769451	hsa-miR-548c-3p	CLIP-seq
MIRT769452	hsa-miR-548u	CLIP-seq
MIRT769453	hsa-miR-548x	CLIP-seq
MIRT769454	hsa-miR-556-3p	CLIP-seq
MIRT1926996	hsa-miR-567	CLIP-seq
MIRT769478	hsa-miR-577	CLIP-seq
MIRT769456	hsa-miR-590-5p	CLIP-seq
MIRT769457	hsa-miR-592	CLIP-seq
MIRT769458	hsa-miR-597	CLIP-seq
MIRT769461	hsa-miR-630	CLIP-seq
MIRT769462	hsa-miR-641	CLIP-seq
MIRT1926997	hsa-miR-643	CLIP-seq
MIRT769463	hsa-miR-653	CLIP-seq
MIRT769464	hsa-miR-655	CLIP-seq
MIRT769465	hsa-miR-656	CLIP-seq
MIRT769466	hsa-miR-664	CLIP-seq
MIRT769467	hsa-miR-759	CLIP-seq
MIRT1926998	hsa-miR-770-5p	CLIP-seq
MIRT769468	hsa-miR-802	CLIP-seq
MIRT769469	hsa-miR-934	CLIP-seq
MIRT1926951	hsa-miR-103a	CLIP-seq
MIRT1926952	hsa-miR-107	CLIP-seq
MIRT1926953	hsa-miR-1184	CLIP-seq
MIRT769366	hsa-miR-1226	CLIP-seq
MIRT769470	hsa-miR-1238	CLIP-seq
MIRT769367	hsa-miR-1243	CLIP-seq
MIRT769368	hsa-miR-1253	CLIP-seq
MIRT1926954	hsa-miR-1257	CLIP-seq
MIRT769369	hsa-miR-1264	CLIP-seq
MIRT1926955	hsa-miR-1267	CLIP-seq
MIRT769370	hsa-miR-1284	CLIP-seq
MIRT769371	hsa-miR-141	CLIP-seq
MIRT769372	hsa-miR-151-3p	CLIP-seq
MIRT769373	hsa-miR-154	CLIP-seq
MIRT1926960	hsa-miR-187	CLIP-seq
MIRT769374	hsa-miR-194	CLIP-seq
MIRT769376	hsa-miR-19a	CLIP-seq
MIRT769377	hsa-miR-19b	CLIP-seq
MIRT769378	hsa-miR-200a	CLIP-seq
MIRT769379	hsa-miR-2052	CLIP-seq
MIRT769380	hsa-miR-21	CLIP-seq
MIRT769382	hsa-miR-23a	CLIP-seq
MIRT769383	hsa-miR-23b	CLIP-seq
MIRT769384	hsa-miR-23c	CLIP-seq
MIRT769385	hsa-miR-2682	CLIP-seq
MIRT769386	hsa-miR-27a	CLIP-seq
MIRT769387	hsa-miR-27b	CLIP-seq
MIRT769388	hsa-miR-28-3p	CLIP-seq
MIRT1926962	hsa-miR-297	CLIP-seq
MIRT769390	hsa-miR-3074-3p	CLIP-seq
MIRT769391	hsa-miR-3120-3p	CLIP-seq
MIRT769392	hsa-miR-3140-3p	CLIP-seq
MIRT1926963	hsa-miR-3149	CLIP-seq
MIRT769393	hsa-miR-3153	CLIP-seq
MIRT1926964	hsa-miR-3176	CLIP-seq
MIRT1926965	hsa-miR-3189-5p	CLIP-seq
MIRT769394	hsa-miR-3201	CLIP-seq
MIRT769395	hsa-miR-3607-5p	CLIP-seq
MIRT769396	hsa-miR-3614-5p	CLIP-seq
MIRT769397	hsa-miR-361-5p	CLIP-seq
MIRT769398	hsa-miR-3617	CLIP-seq
MIRT1926968	hsa-miR-3652	CLIP-seq
MIRT1926969	hsa-miR-3680	CLIP-seq
MIRT769400	hsa-miR-3714	CLIP-seq
MIRT769401	hsa-miR-371-5p	CLIP-seq
MIRT769402	hsa-miR-371b-5p	CLIP-seq
MIRT1926973	hsa-miR-3922-3p	CLIP-seq
MIRT769407	hsa-miR-3941	CLIP-seq
MIRT769408	hsa-miR-3942-3p	CLIP-seq
MIRT769409	hsa-miR-409-3p	CLIP-seq
MIRT769411	hsa-miR-4256	CLIP-seq
MIRT769412	hsa-miR-4302	CLIP-seq
MIRT769413	hsa-miR-4315	CLIP-seq
MIRT769414	hsa-miR-4328	CLIP-seq
MIRT769415	hsa-miR-433	CLIP-seq
MIRT1926974	hsa-miR-4418	CLIP-seq
MIRT1926976	hsa-miR-4430	CLIP-seq
MIRT769416	hsa-miR-4446-5p	CLIP-seq
MIRT769417	hsa-miR-4457	CLIP-seq
MIRT769418	hsa-miR-4463	CLIP-seq
MIRT769419	hsa-miR-4499	CLIP-seq
MIRT769420	hsa-miR-449c	CLIP-seq
MIRT769421	hsa-miR-4503	CLIP-seq
MIRT1926978	hsa-miR-4505	CLIP-seq
MIRT1926981	hsa-miR-455-3p	CLIP-seq
MIRT769422	hsa-miR-455-5p	CLIP-seq
MIRT769423	hsa-miR-4643	CLIP-seq
MIRT769424	hsa-miR-4645-5p	CLIP-seq
MIRT769425	hsa-miR-466	CLIP-seq
MIRT769426	hsa-miR-4661-5p	CLIP-seq
MIRT2167837	hsa-miR-4668-3p	CLIP-seq
MIRT769427	hsa-miR-4672	CLIP-seq
MIRT769428	hsa-miR-4673	CLIP-seq
MIRT1926982	hsa-miR-4684-3p	CLIP-seq
MIRT1926984	hsa-miR-4696	CLIP-seq
MIRT769475	hsa-miR-4698	CLIP-seq
MIRT769429	hsa-miR-4704-3p	CLIP-seq
MIRT769430	hsa-miR-4709-5p	CLIP-seq
MIRT1926986	hsa-miR-4712-5p	CLIP-seq
MIRT769431	hsa-miR-4719	CLIP-seq
MIRT769432	hsa-miR-4733-3p	CLIP-seq
MIRT1926989	hsa-miR-4757-5p	CLIP-seq
MIRT1926990	hsa-miR-4758-3p	CLIP-seq
MIRT1926992	hsa-miR-4781-3p	CLIP-seq
MIRT769435	hsa-miR-4789-3p	CLIP-seq
MIRT769436	hsa-miR-4789-5p	CLIP-seq
MIRT769437	hsa-miR-4790-5p	CLIP-seq
MIRT769438	hsa-miR-4791	CLIP-seq
MIRT1926993	hsa-miR-4798-3p	CLIP-seq
MIRT2167838	hsa-miR-508-3p	CLIP-seq
MIRT1926994	hsa-miR-509-3-5p	CLIP-seq
MIRT1926995	hsa-miR-509-5p	CLIP-seq
MIRT769440	hsa-miR-5096	CLIP-seq
MIRT769441	hsa-miR-513a-5p	CLIP-seq
MIRT769442	hsa-miR-513b	CLIP-seq
MIRT769443	hsa-miR-513c	CLIP-seq
MIRT769444	hsa-miR-514b-5p	CLIP-seq
MIRT769445	hsa-miR-518a-5p	CLIP-seq
MIRT769446	hsa-miR-527	CLIP-seq
MIRT769447	hsa-miR-548ae	CLIP-seq
MIRT769448	hsa-miR-548aj	CLIP-seq
MIRT769449	hsa-miR-548am	CLIP-seq
MIRT769451	hsa-miR-548c-3p	CLIP-seq
MIRT769452	hsa-miR-548u	CLIP-seq
MIRT769453	hsa-miR-548x	CLIP-seq
MIRT769454	hsa-miR-556-3p	CLIP-seq
MIRT1926996	hsa-miR-567	CLIP-seq
MIRT769455	hsa-miR-570	CLIP-seq
MIRT769456	hsa-miR-590-5p	CLIP-seq
MIRT769457	hsa-miR-592	CLIP-seq
MIRT769458	hsa-miR-597	CLIP-seq
MIRT769460	hsa-miR-624	CLIP-seq
MIRT769461	hsa-miR-630	CLIP-seq
MIRT769462	hsa-miR-641	CLIP-seq
MIRT1926997	hsa-miR-643	CLIP-seq
MIRT769463	hsa-miR-653	CLIP-seq
MIRT769465	hsa-miR-656	CLIP-seq
MIRT769466	hsa-miR-664	CLIP-seq
MIRT769467	hsa-miR-759	CLIP-seq
MIRT1926998	hsa-miR-770-5p	CLIP-seq
MIRT769468	hsa-miR-802	CLIP-seq
MIRT769469	hsa-miR-934	CLIP-seq
MIRT1926960	hsa-miR-187	CLIP-seq
MIRT769380	hsa-miR-21	CLIP-seq
MIRT769382	hsa-miR-23a	CLIP-seq
MIRT769383	hsa-miR-23b	CLIP-seq
MIRT769384	hsa-miR-23c	CLIP-seq
MIRT769440	hsa-miR-5096	CLIP-seq
MIRT769456	hsa-miR-590-5p	CLIP-seq
MIRT769375	hsa-miR-198	CLIP-seq
MIRT1926961	hsa-miR-2277-3p	CLIP-seq
MIRT769389	hsa-miR-300	CLIP-seq
MIRT2470432	hsa-miR-337-3p	CLIP-seq
MIRT769399	hsa-miR-369-3p	CLIP-seq
MIRT769403	hsa-miR-374a	CLIP-seq
MIRT769404	hsa-miR-374b	CLIP-seq
MIRT769405	hsa-miR-374c	CLIP-seq
MIRT769406	hsa-miR-381	CLIP-seq
MIRT2167837	hsa-miR-4668-3p	CLIP-seq
MIRT769451	hsa-miR-548c-3p	CLIP-seq
MIRT769464	hsa-miR-655	CLIP-seq
MIRT1926961	hsa-miR-2277-3p	CLIP-seq
MIRT769389	hsa-miR-300	CLIP-seq
MIRT2470432	hsa-miR-337-3p	CLIP-seq
MIRT769399	hsa-miR-369-3p	CLIP-seq
MIRT769403	hsa-miR-374a	CLIP-seq
MIRT769404	hsa-miR-374b	CLIP-seq
MIRT769405	hsa-miR-374c	CLIP-seq
MIRT769406	hsa-miR-381	CLIP-seq
MIRT2167837	hsa-miR-4668-3p	CLIP-seq
MIRT769451	hsa-miR-548c-3p	CLIP-seq
MIRT769464	hsa-miR-655	CLIP-seq

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005507	Function	Copper ion binding	IEA
GO:0005515	Function	Protein binding	IPI	20562864, 21888893, 24981860, 27705803, 29795351, 33961781, 35271311, 36950384
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0007614	Process	Short-term memory	IEA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009743	Process	Response to carbohydrate	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0033484	Process	Intracellular nitric oxide homeostasis	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044849	Process	Estrous cycle	IEA
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	29795351

MIM	HGNC	e!Ensembl
611386	15766	ENSG00000101126

Protein

UniProt ID

Q9H2P0

Protein name

Activity-dependent neuroprotector homeobox protein (Activity-dependent neuroprotective protein)

Protein function

May be involved in transcriptional regulation. May mediate some of the neuroprotective peptide VIP-associated effects involving normal growth and cancer proliferation. Positively modulates WNT-beta-catenin/CTNN1B signaling, acting by regulating

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	765 → 813	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Strong expression in heart, skeletal muscle, kidney and placenta. In brain, expression is stronger in the cerebellum and cortex regions. No expression detected in the colon. Strong increase of expression in colon and

Sequence

MFQLPVNNLGSLRKARKTVKKILSDIGLEYCKEHIEDFKQFEPNDFYLKNTTWEDVGLWD
PSLTKNQDYRTKPFCCSACPFSSKFFSAYKSHFRNVHSEDFENRILLNCPYCTFNADKKT
LETHIKIFHAPNASAPSSSLSTFKDKNKNDGLKPKQADSVEQAVYYCKKCTYRDPLYEIV
RKHIYREHFQHVAAPYIAKAGEKSLNGAVPLGSNAREESSIHCKRCLFMPKSYEALVQHV
IEDHERIGYQVTAMIGHTNVVVPRSKPLMLIAPKPQDKKSMGLPPRIGSLASGNVRSLPS
QQMVNRLSIPKPNLNSTGVNMMSSVHLQQNNYGVKSVGQGYSVGQSMRLGLGGNAPVSIP
QQSQSVKQLLPSGNGRSYGLGSEQRSQAPARYSLQSANASSLSSGQLKSPSLSQSQASRV
LGQSSSKPAAAATGPPPGNTSSTQKWKICTICNELFPENVYSVHFEKEHKAEKVPAVANY
IMKIHNFTSKCLYCNRYLPTDTLLNHMLIHGLSCPYCRSTFNDVEKMAAHMRMVHIDEEM
GPKTDSTLSFDLTLQQGSHTNIHLLVTTYNLRDAPAESVAYHAQNNPPVPPKPQPKVQEK
ADIPVKSSPQAAVPYKKDVGKTLCPLCFSILKGPISDALAHHLRERHQVIQTVHPVEKKL
TYKCIHCLGVYTSNMTASTITLHLVHCRGVGKTQNGQDKTNAPSRLNQSPSLAPVKRTYE
QMEFPLLKKRKLDDDSDSPSFFEEKPEEPVVLALDPKGHEDDSYEARKSFLTKYFNKQPY
PTRREIEKLAASLWLWKSDIASHFSNKRKKCVRDCEKYKPGVLLGFNMKELNKVKHEMDF
DAEWLFENHDEKDSRVNASKTADKKLNLGKEDDSSSDSFENLEEESNESGSPFDPVFEVE
PKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQD
DVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQ
GDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNM
TDGVAEPMHGSLAGVKLSSQQA

Sequence length

1102

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Developmental Delay	global developmental delay	rs1057518991	N/A
Mental retardation	intellectual disability	rs587777522, rs1135401808	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Microcephaly	microcephaly	N/A	N/A	ClinVar
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	26639975
Affective Disorders Psychotic	Associate	30107084
Alzheimer Disease	Associate	26639975, 31664177, 36230962, 39766225
Aneurysm	Associate	36553633
Anorectal Malformations	Associate	36474027
Aphasia	Associate	39950682
Autism Spectrum Disorder	Associate	24531329, 27790361, 29724491, 30107084, 32275126, 32887689, 33998396, 36553633, 37366052, 38254177
Autistic Disorder	Associate	24531329, 27790361, 29724491, 31264075, 31664177, 32661233, 32918531, 35982159, 36230962
Bland White Garland Syndrome	Associate	36553633
Blood Coagulation Disorders	Associate	37525242
Brain Diseases	Associate	29724491
Carcinoma Hepatocellular	Associate	37525242
Cardiomyopathy Restrictive	Associate	30107084
Choroidal Effusions	Associate	36553633
Ciliary Dyskinesia With Transposition Of Ciliary Microtubules	Associate	31664177
Cognitive Dysfunction	Stimulate	26639975
Cognitive Dysfunction	Associate	31664177
Congenital Abnormalities	Associate	30107084
Coronary Artery Disease	Associate	36553633
Dependent Personality Disorder	Associate	30107084, 38254177
Developmental Disabilities	Associate	29724491, 31264075, 36553633, 38254177, 39950682
Diabetes Mellitus Type 2	Associate	36631441
Dwarfism Pituitary	Associate	29724491
Epilepsy	Associate	29724491
Facial Dysmorphism with Multiple Malformations	Associate	24531329
Fetal Alcohol Spectrum Disorders	Associate	38254177
Funnel Chest	Associate	36553633
Growth Disorders	Associate	29724491
Heart Defects Congenital	Associate	29724491, 32341405
Intellectual Disability	Associate	24531329, 29724491, 30107084, 31264075, 31664177, 36553633, 36828924, 38254177
Intestinal Neoplasms	Associate	11013255
Language Development Disorders	Associate	29724491
Learning Disabilities	Associate	32341405
Lymphoma Large B Cell Diffuse	Associate	33663517
Mucocutaneous Lymph Node Syndrome	Associate	36553633
Muscle Hypotonia	Associate	30107084
Muscular Atrophy	Associate	31264075
Myotonic Dystrophy	Inhibit	36631441
Neoplasms	Associate	11013255, 37525242
Ovarian Neoplasms	Associate	11013255, 31767542, 37525242
Pectus Carinatum	Associate	36553633
Signs and Symptoms Digestive	Associate	29724491
Sleep Wake Disorders	Associate	29724491, 33998396
Syndrome	Associate	29899371, 31029150, 39307104
Tauopathies	Associate	31664177, 32661233
Tay Sachs Disease AB Variant	Associate	31664177
Thrombophilia due to Activated Protein C Resistance	Associate	32661233, 39950682
Urinary Bladder Neoplasms	Associate	37525242
Van der Woude syndrome	Associate	29724491, 29899371, 29911927, 32758449, 36553633, 38254177, 39232847
Van Maldergem Wetzburger Verloes syndrome	Associate	36553633
Vision Disorders	Associate	29724491

ADNP (activity dependent neuroprotector homeobox)