Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23316
Gene name Gene Name - the full gene name approved by the HGNC.	Cut like homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CUX2
Synonyms (NCBI Gene) Gene synonyms aliases	CDP2, CUTL2, DEE67, EIEE67
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.11-q24.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein which contains three CUT domains and a homeodomain; both domains are DNA-binding motifs. A similar gene, whose gene product possesses different DNA-binding activities, is located on chromosome on chromosome 7. Two pseudogenes o

Show/Hide all(54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022380	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT538246	hsa-miR-451a	PAR-CLIP	22012620
MIRT538247	hsa-miR-552-5p	PAR-CLIP	22012620
MIRT538245	hsa-miR-4455	PAR-CLIP	22012620
MIRT538246	hsa-miR-451a	PAR-CLIP	22012620
MIRT538247	hsa-miR-552-5p	PAR-CLIP	22012620
MIRT538245	hsa-miR-4455	PAR-CLIP	22012620
MIRT917361	hsa-miR-1224-3p	CLIP-seq
MIRT917362	hsa-miR-1470	CLIP-seq
MIRT917363	hsa-miR-3591-3p	CLIP-seq
MIRT917364	hsa-miR-4271	CLIP-seq
MIRT917365	hsa-miR-4287	CLIP-seq
MIRT917366	hsa-miR-4326	CLIP-seq
MIRT917367	hsa-miR-4426	CLIP-seq
MIRT917368	hsa-miR-4469	CLIP-seq
MIRT917369	hsa-miR-4647	CLIP-seq
MIRT917370	hsa-miR-4662b	CLIP-seq
MIRT917371	hsa-miR-4667-3p	CLIP-seq
MIRT917372	hsa-miR-4685-3p	CLIP-seq
MIRT917373	hsa-miR-4691-5p	CLIP-seq
MIRT917374	hsa-miR-4725-3p	CLIP-seq
MIRT917375	hsa-miR-563	CLIP-seq
MIRT917376	hsa-miR-570	CLIP-seq
MIRT2207670	hsa-miR-1976	CLIP-seq
MIRT2207671	hsa-miR-2467-3p	CLIP-seq
MIRT2207672	hsa-miR-3158-5p	CLIP-seq
MIRT2207673	hsa-miR-3159	CLIP-seq
MIRT2207674	hsa-miR-3678-3p	CLIP-seq
MIRT2207675	hsa-miR-376a	CLIP-seq
MIRT2207676	hsa-miR-376b	CLIP-seq
MIRT2207677	hsa-miR-377	CLIP-seq
MIRT2207678	hsa-miR-3977	CLIP-seq
MIRT2207679	hsa-miR-4727-5p	CLIP-seq
MIRT2207680	hsa-miR-668	CLIP-seq
MIRT2207681	hsa-miR-767-3p	CLIP-seq
MIRT2207682	hsa-miR-939	CLIP-seq
MIRT2510946	hsa-miR-3180-5p	CLIP-seq
MIRT2510947	hsa-miR-3198	CLIP-seq
MIRT2207674	hsa-miR-3678-3p	CLIP-seq
MIRT2510948	hsa-miR-4297	CLIP-seq
MIRT2510949	hsa-miR-4309	CLIP-seq
MIRT2510950	hsa-miR-4653-3p	CLIP-seq
MIRT2510951	hsa-miR-520a-5p	CLIP-seq
MIRT2510952	hsa-miR-525-5p	CLIP-seq
MIRT2510953	hsa-miR-532-5p	CLIP-seq
MIRT2510946	hsa-miR-3180-5p	CLIP-seq
MIRT2510947	hsa-miR-3198	CLIP-seq
MIRT2207674	hsa-miR-3678-3p	CLIP-seq
MIRT2510948	hsa-miR-4297	CLIP-seq
MIRT2510949	hsa-miR-4309	CLIP-seq
MIRT2510950	hsa-miR-4653-3p	CLIP-seq
MIRT2510951	hsa-miR-520a-5p	CLIP-seq
MIRT2510952	hsa-miR-525-5p	CLIP-seq
MIRT2510953	hsa-miR-532-5p	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15656993
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15656993
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007614	Process	Short-term memory	IEA
GO:0007614	Process	Short-term memory	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	15656993
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IEA
GO:0050775	Process	Positive regulation of dendrite morphogenesis	ISS
GO:0050890	Process	Cognition	IMP	15389760
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	IEA
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS

MIM	HGNC	e!Ensembl
610648	19347	ENSG00000111249

Protein

UniProt ID

O14529

Protein name

Homeobox protein cut-like 2 (Homeobox protein cux-2)

Protein function

Transcription factor involved in the control of neuronal proliferation and differentiation in the brain. Regulates dendrite development and branching, dendritic spine formation, and synaptogenesis in cortical layers II-III. Binds to DNA in a seq

PDB

1WH6 , 1WH8 , 1X2L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02376	CUT	549 → 627	CUT domain	Domain
PF02376	CUT	892 → 967	CUT domain	Domain
PF02376	CUT	1043 → 1120	CUT domain	Domain
PF00046	Homeodomain	1169 → 1225	Homeodomain	Domain

Sequence

MAANVGSMFQYWKRFDLRRLQKELNSVASELSARQEESEHSHKHLIELRREFKKNVPEEI
REMVAPVLKSFQAEVVALSKRSQEAEAAFLSVYKQLIEAPDPVPVFEAARSLDDRLQPPS
FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQR
NEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAELLELRRKYDEEAASKADEVG
LIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCSPQGPSGDKVNFTLCSGPRLE
AALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIEKLEEKLQAQS
DYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPE
EDPSEDDSIKDSLGTEQSYPSPQQLPPPPGPEDPLSPSPGQPLLGPSLGPDGTRTFSLSP
FPSLASGERLMMPPAAFKGEAGGLLVFPPAFYGAKPPTAPATPAPGPEPLGGPEPADGGG
GGAAGPGAEEEQLDTAEIAFQVKEQLLKHNIGQRVFGHYVLGLSQGSVSEILARPKPWRK
LTVKGKEPFIKMKQFLSDEQNVLALRTIQVRQRGSITPRIRTPETGSDDAIKSILEQAKK
EIESQKGGEPKTSVAPLSIANGTTPASTSEDAIKSILEQARREMQAQQQALLEMEVAPRG
RSVPPSPPERPSLATASQNGAPALVKQEEGSGGPAQAPLPVLSPAAFVQSIIRKVKSEIG
DAGYFDHHWASDRGLLSRPYASVSPSLSSSSSSGYSGQPNGRAWPRGDEAPVPPEDEAAA
GAEDEPPRTGELKAEGATAEAGARLPYYPAYVPRTLKPTVPPLTPEQYELYMYREVDTLE
LTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLS
DQLGQAVGQQPGASQASPTEPRSSPSPPPSPTEPEKSSQEPLSLSLESSKENQQPEGRSS
SSLSGKMYSGSQAPGGIQEIVAMSPELDTYSITKRVKEVLTDNNLGQRLFGESILGLTQG
SVSDLLSRPKPWHKLSLKGREPFVRMQLWLNDPHNVEKLRDMKKLEKKAYLKRRYGLIST
GSDSESPATRSECPSPCLQPQDLSLLQIKKPRVVLAPEEKEALRKAYQLEPYPSQQTIEL
LSFQLNLKTNTVINWFHNYRSRMRREMLVEGTQDEPDLDPSGGPGILPPGHSHPDPTPQS
PDSETEDQKPTVKELELQEGPEENSTPLTTQDKAQVRIKQEQMEEDAEEEAGSQPQDSGE
LDKGQGPPKEEHPDPPGNDGLPKVAPGPLLPGGSTPDCPSLHPQQESEAGERLHPDPLSF
KSASESSRCSLEVSLNSPSAASSPGLMMSVSPVPSSSAPISPSPPGAPPAKVPSASPTAD
MAGALHPSAKVNPNLQRRHEKMANLNNIIYRVERAANREEALEWEF

Sequence length

1486

Interactions

View interactions

Show/Hide Unknown Diseases (11)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Breast cancer	Breast cancer	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Developmental And Epileptic Encephalopathy	Developmental and epileptic encephalopathy, 67, genetic developmental and epileptic encephalopathy	N/A	N/A	ClinVar, GenCC
Epilepsy	Epilepsy	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Lennox-Gastaut Syndrome	Lennox-Gastaut syndrome	N/A	N/A	GenCC
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Atrial Fibrillation	Associate	28067321, 29459676
Autism Spectrum Disorder	Associate	29795476
Autistic Disorder	Associate	29630738, 29795476
Brain Diseases	Associate	29630738, 29795476
Breast Neoplasms	Associate	37308906
Cognition Disorders	Associate	29630738, 29795476
Coronary Artery Disease	Associate	34447459
Crohn Disease	Associate	12631665
Diabetes Mellitus	Associate	25646370
Diabetes Mellitus Type 1	Associate	22293688
Diabetes Mellitus Type 2	Associate	32722627
Epilepsies Myoclonic	Associate	29630738
Epilepsy	Associate	29630738, 29795476
Epilepsy Absence	Associate	29630738
Epilepsy Generalized	Associate	29630738
Epileptic Encephalopathy Early Infantile 3	Associate	29630738
Gout	Associate	25646370, 27181629
Helicobacter Infections	Associate	30281874
Hypertension	Associate	32854392
Infantile Epileptic Dyskinetic Encephalopathy	Associate	29630738
Intellectual Disability	Associate	29795476
Lennox Gastaut Syndrome	Associate	29630738
Prediabetic State	Associate	32722627
Rosacea	Associate	39272052
Seizures	Associate	29630738, 29795476
Stomach Neoplasms	Associate	30281874

CUX2 (cut like homeobox 2)