ICOSLG (inducible T cell costimulator ligand)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 23308
Gene name Inducible T cell costimulator ligand
Gene symbol ICOSLG
Synonyms (NCBI Gene)
B7-H2B7H2B7RP-1B7RP1B7hCD275GL50ICOS-LICOSLIMD119LICOS
Chromosome 21
Chromosome location 21q22.3
SNPs SNP information provided by dbSNP.
1
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
SNP ID Visualize variation Clinical significance Consequence
rs1165558487 C>A,T Likely-pathogenic Intron variant, splice donor variant
miRNA miRNA information provided by mirtarbase database.
674
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (674)
miRTarBase ID miRNA Experiments Reference
MIRT039046 hsa-miR-766-3p CLASH 23622248
MIRT716789 hsa-miR-6769a-3p HITS-CLIP 19536157
MIRT716790 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT716788 hsa-miR-4459 HITS-CLIP 19536157
MIRT716787 hsa-miR-665 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (27)
GO ID Ontology Definition Evidence Reference
GO:0001817 Process Regulation of cytokine production IBA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605717 17087 ENSG00000160223
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75144
Protein name ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)
Protein function Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion (PubMed:11007762, PubMed:11023515, PubMed:30498080). Also induces B-cell proliferation and differentiation
PDB 6X4G , 6X4T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 20 → 133 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on peripheral blood B-cells and monocytes, as well as on monocyte-derived dendritic cells (at protein level). {ECO:0000269|PubMed:10779774, ECO:0000269|PubMed:11007762, ECO:0000269|PubMed:11023515}.; TISSUE SPECIFICITY: [Isof
Sequence 
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
Sequence length 302
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cell adhesion molecules
Intestinal immune network for IgA production 		  Costimulation by the CD28 family
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Combined immunodeficiency Likely pathogenic rs2146342598 RCV001824255
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Likely benign rs142566111 RCV005926172
Hepatocellular carcinoma Uncertain significance rs191360035 RCV005924334
Immunodeficiency 119 Uncertain significance rs778848090 RCV004577414
Show/Hide Text Mining Associations (51)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenomyosis Associate 34289871
Allergic Fungal Sinusitis Associate 15961727, 37325657
Alopecia Areata Associate 23196741
Arthritis Rheumatoid Associate 17323353
Autoimmune Diseases Associate 26560438
Bantu siderosis Stimulate 34083737
Breast Neoplasms Associate 31292534
Carcinoma Hepatocellular Associate 30942404
Carcinoma Non Small Cell Lung Associate 32555523
Carcinoma Pancreatic Ductal Inhibit 20976171