Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23308
Gene name Gene Name - the full gene name approved by the HGNC.
Inducible T cell costimulator ligand
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ICOSLG
Synonyms (NCBI Gene) Gene synonyms aliases
B7-H2, B7H2, B7RP-1, B7RP1, B7h, CD275, GL50, ICOS-L, ICOSL, IMD119, LICOS
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IMD119
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1165558487 C>A,T Likely-pathogenic Intron variant, splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039046 hsa-miR-766-3p CLASH 23622248
MIRT716789 hsa-miR-6769a-3p HITS-CLIP 19536157
MIRT716790 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT716788 hsa-miR-4459 HITS-CLIP 19536157
MIRT716787 hsa-miR-665 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001817 Process Regulation of cytokine production IBA 21873635
GO:0002250 Process Adaptive immune response IEA
GO:0005102 Function Signaling receptor binding IBA 21873635
GO:0005102 Function Signaling receptor binding TAS 11429535
GO:0005515 Function Protein binding IPI 11956294, 16951355
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605717 17087 ENSG00000160223
Protein
UniProt ID O75144
Protein name ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)
Protein function Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion (PubMed:11007762, PubMed:11023515, PubMed:30498080). Also induces B-cell proliferation and differentiation
PDB 6X4G , 6X4T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 20 133 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on peripheral blood B-cells and monocytes, as well as on monocyte-derived dendritic cells (at protein level). {ECO:0000269|PubMed:10779774, ECO:0000269|PubMed:11007762, ECO:0000269|PubMed:11023515}.; TISSUE SPECIFICITY: [Isof
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLH
VAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
Sequence length 302
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Intestinal immune network for IgA production
  Costimulation by the CD28 family
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs869025224 21383967
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
22190364
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 30423114, 24390342
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 21150878 ClinVar
Celiac disease Celiac Disease, Celiac disease 20190752 ClinVar, GWAS
Immunodeficiency immunodeficiency 119 GenCC
Severe combined immunodeficiency disease combined immunodeficiency GenCC
Associations from Text Mining
Disease Name Relationship Type References
Adenomyosis Associate 34289871
Allergic Fungal Sinusitis Associate 15961727, 37325657
Alopecia Areata Associate 23196741
Arthritis Rheumatoid Associate 17323353
Autoimmune Diseases Associate 26560438
Bantu siderosis Stimulate 34083737
Breast Neoplasms Associate 31292534
Carcinoma Hepatocellular Associate 30942404
Carcinoma Non Small Cell Lung Associate 32555523
Carcinoma Pancreatic Ductal Inhibit 20976171