TSPYL4 (TSPY like 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 23270
Gene name TSPY like 4
Gene symbol TSPYL4
Synonyms (NCBI Gene)
dJ486I3.2
Chromosome 6
Chromosome location 6q22.1
miRNA miRNA information provided by mirtarbase database.
814
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (814)
miRTarBase ID miRNA Experiments Reference
MIRT021145 hsa-miR-186-5p Sequencing 20371350
MIRT486911 hsa-miR-6760-5p PAR-CLIP 20371350
MIRT486909 hsa-miR-4716-3p PAR-CLIP 20371350
MIRT486908 hsa-miR-6794-5p PAR-CLIP 20371350
MIRT486906 hsa-miR-4419a PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0003682 Function Chromatin binding IBA
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619586 21559 ENSG00000187189
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJ04
Protein name Testis-specific Y-encoded-like protein 4 (TSPY-like protein 4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00956 NAP 247 → 388 Nucleosome assembly protein (NAP) Family
Sequence 
MSGLDGGNKLPLAQTGGLAAPDHASGDPDRDQCQGLREETEATQVMANTGGGSLETVAEG
GASQDPVDCGPALRVPVAGSRGGAATKAGQEDAPPSTKGLEAASAAEAADSSQKNGCQLG
EPRGPAGQKALEACGAGGLGSQMIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQ
KEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHM
QRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIF
QGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNTIPSFFNWFSD
HSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG
Sequence length 414
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MELANOMA — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (3)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Colorectal Neoplasms Associate 34537824
★★★★★
★☆☆☆☆
Found in Text Mining only
Death Sudden Associate 15273283
★★★★★
★☆☆☆☆
Found in Text Mining only
Sudden Infant Death with Dysgenesis of the Testes Syndrome Associate 15273283
★★★★★
★☆☆☆☆
Found in Text Mining only