Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23246
Gene name Gene Name - the full gene name approved by the HGNC.	BOP1 ribosomal biogenesis factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BOP1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.3

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043142	hsa-miR-324-5p	CLASH	23622248
MIRT038393	hsa-miR-296-3p	CLASH	23622248
MIRT2182204	hsa-miR-4323	CLIP-seq
MIRT2182205	hsa-miR-4514	CLIP-seq
MIRT2182206	hsa-miR-4645-5p	CLIP-seq
MIRT2182207	hsa-miR-4673	CLIP-seq
MIRT2182208	hsa-miR-4692	CLIP-seq
MIRT2182209	hsa-miR-940	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000027	Process	Ribosomal large subunit assembly	IMP	24120868
GO:0000448	Process	Cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA
GO:0000460	Process	Maturation of 5.8S rRNA	IEA
GO:0000463	Process	Maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0000463	Process	Maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA
GO:0000463	Process	Maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IMP	17353269
GO:0000466	Process	Maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	16043514, 16738141, 17353269, 25825154, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0030687	Component	Preribosome, large subunit precursor	IBA
GO:0030687	Component	Preribosome, large subunit precursor	IEA
GO:0042254	Process	Ribosome biogenesis	IC	17353269
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042254	Process	Ribosome biogenesis	NAS	16043514
GO:0042273	Process	Ribosomal large subunit biogenesis	IEA
GO:0042273	Process	Ribosomal large subunit biogenesis	IEA
GO:0043021	Function	Ribonucleoprotein complex binding	IBA
GO:0043021	Function	Ribonucleoprotein complex binding	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	16043514
GO:0070545	Component	PeBoW complex	IBA
GO:0070545	Component	PeBoW complex	IDA	16043514, 16738141, 17353269
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IMP	24120868
GO:1990904	Component	Ribonucleoprotein complex	IDA	18809582

MIM	HGNC	e!Ensembl
610596	15519	ENSG00000261236

Protein

UniProt ID

Q14137

Protein name

Ribosome biogenesis protein BOP1 (Block of proliferation 1 protein)

Protein function

Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.

PDB

8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08145	BOP1NT	144 → 402	BOP1NT (NUC169) domain	Domain
PF00400	WD40	403 → 441	WD domain, G-beta repeat	Repeat
PF00400	WD40	653 → 689	WD domain, G-beta repeat	Repeat
PF00400	WD40	704 → 746	WD domain, G-beta repeat	Repeat

Sequence

MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVF
SGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGD
EYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPD
YWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRP
ADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHV
PAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFI
QERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLS
VSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVL
LLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQV
TWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQR
SVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLR
HHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLG
VLDVIFHPTQPWVFSSGADGTVRLFT

Sequence length

746

Interactions

View interactions

	Reactome
			Major pathway of rRNA processing in the nucleolus and cytosol

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Aortic Dissection	Inhibit	31210846
Breast Neoplasms	Associate	36497066
Cap Myopathy	Associate	37681336
Carcinogenesis	Associate	32167616
Carcinoma Hepatocellular	Associate	33228611
Colorectal Neoplasms	Associate	18959792
Colorectal Neoplasms	Stimulate	32167616
Digestive System Neoplasms	Associate	35222794
Neoplasm Metastasis	Associate	32167616, 37681336
Neoplasms	Associate	35222794
Neoplasms	Stimulate	37681336
Ovarian Neoplasms	Associate	22174824
Prostatic Neoplasms	Associate	37681336
Rectal Neoplasms	Associate	18959792
Stomach Neoplasms	Associate	35222794

BOP1 (BOP1 ribosomal biogenesis factor)