Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2324
Gene name	Fms related receptor tyrosine kinase 4
Gene symbol	FLT4
Synonyms (NCBI Gene)	CHTD7FLT-4FLT41LMPH1ALMPHM1PCLVEGFR-3VEGFR3
Chromosome	5
Chromosome location	5q35.3
Summary	This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type

Show/Hide all (17)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34255532	G>A,C	Pathogenic, uncertain-significance, benign	Non coding transcript variant, coding sequence variant, missense variant
rs121909650	C>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909651	A>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909652	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909653	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909654	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909655	A>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909656	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909657	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs267606818	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs587776833	AGA>-	Pathogenic	Non coding transcript variant, inframe deletion, coding sequence variant
rs755445139	G>-,GG	Pathogenic	Frameshift variant, non coding transcript variant, upstream transcript variant, coding sequence variant, genic upstream transcript variant
rs1451816005	G>A	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1554109707	C>G,T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs1554115894	A>G	Drug-response	Coding sequence variant, 5 prime UTR variant, non coding transcript variant, missense variant
rs1581616817	G>A	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs1581655293	->C	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043539	hsa-miR-331-3p	CLASH	23622248
MIRT053184	hsa-miR-1236-3p	Luciferase reporter assaypSILACqRT-PCRWestern blot	22223733
MIRT053184	hsa-miR-1236-3p	Luciferase reporter assaypSILACqRT-PCRWestern blot	22223733
MIRT999075	hsa-miR-1184	CLIP-seq
MIRT999076	hsa-miR-1205	CLIP-seq
MIRT999077	hsa-miR-1266	CLIP-seq
MIRT999078	hsa-miR-1293	CLIP-seq
MIRT999079	hsa-miR-2467-3p	CLIP-seq
MIRT999080	hsa-miR-3132	CLIP-seq
MIRT999081	hsa-miR-3150b-3p	CLIP-seq
MIRT999082	hsa-miR-3158-5p	CLIP-seq
MIRT999083	hsa-miR-3174	CLIP-seq
MIRT999084	hsa-miR-3184	CLIP-seq
MIRT999085	hsa-miR-3664-3p	CLIP-seq
MIRT999086	hsa-miR-3678-3p	CLIP-seq
MIRT999087	hsa-miR-3925-3p	CLIP-seq
MIRT999088	hsa-miR-423-5p	CLIP-seq
MIRT999089	hsa-miR-4257	CLIP-seq
MIRT999090	hsa-miR-4483	CLIP-seq
MIRT999091	hsa-miR-4512	CLIP-seq
MIRT999092	hsa-miR-4518	CLIP-seq
MIRT999093	hsa-miR-4646-5p	CLIP-seq
MIRT999094	hsa-miR-4689	CLIP-seq
MIRT999095	hsa-miR-4716-3p	CLIP-seq
MIRT999096	hsa-miR-4723-5p	CLIP-seq
MIRT999097	hsa-miR-4728-5p	CLIP-seq
MIRT999098	hsa-miR-4731-5p	CLIP-seq
MIRT999099	hsa-miR-4747-5p	CLIP-seq
MIRT999100	hsa-miR-4755-3p	CLIP-seq
MIRT999101	hsa-miR-4783-5p	CLIP-seq
MIRT999102	hsa-miR-4784	CLIP-seq
MIRT999103	hsa-miR-486-3p	CLIP-seq
MIRT999104	hsa-miR-512-3p	CLIP-seq
MIRT999105	hsa-miR-515-5p	CLIP-seq
MIRT999106	hsa-miR-520a-5p	CLIP-seq
MIRT999107	hsa-miR-525-5p	CLIP-seq
MIRT999108	hsa-miR-665	CLIP-seq
MIRT999109	hsa-miR-766	CLIP-seq
MIRT999110	hsa-miR-921	CLIP-seq
MIRT1996052	hsa-miR-1908	CLIP-seq
MIRT1996053	hsa-miR-3180	CLIP-seq
MIRT1996054	hsa-miR-3180-3p	CLIP-seq
MIRT1996055	hsa-miR-3196	CLIP-seq
MIRT1996056	hsa-miR-4787-5p	CLIP-seq
MIRT1996057	hsa-miR-663	CLIP-seq
MIRT1996058	hsa-miR-759	CLIP-seq
MIRT999077	hsa-miR-1266	CLIP-seq
MIRT2388022	hsa-miR-1275	CLIP-seq
MIRT999084	hsa-miR-3184	CLIP-seq
MIRT999085	hsa-miR-3664-3p	CLIP-seq
MIRT999088	hsa-miR-423-5p	CLIP-seq
MIRT2388023	hsa-miR-4254	CLIP-seq
MIRT2388024	hsa-miR-4260	CLIP-seq
MIRT999092	hsa-miR-4518	CLIP-seq
MIRT2388025	hsa-miR-4665-5p	CLIP-seq
MIRT999095	hsa-miR-4716-3p	CLIP-seq
MIRT999096	hsa-miR-4723-5p	CLIP-seq
MIRT999097	hsa-miR-4728-5p	CLIP-seq
MIRT999103	hsa-miR-486-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Activation	19901262
RELA	Activation	19901262

Show/Hide all (74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	19779139
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	11532940
GO:0001944	Process	Vasculature development	IEA
GO:0001944	Process	Vasculature development	ISS
GO:0001945	Process	Lymph vessel development	IEA
GO:0001945	Process	Lymph vessel development	ISS
GO:0001946	Process	Lymphangiogenesis	IEA
GO:0001946	Process	Lymphangiogenesis	IMP	19779139
GO:0001946	Process	Lymphangiogenesis	ISS
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0003016	Process	Respiratory system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IMP	7898938
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	8386825
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IBA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IDA	9012504, 23878260
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IEA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IMP	11532940, 19779139
GO:0005021	Function	Vascular endothelial growth factor receptor activity	TAS	10835628
GO:0005515	Function	Protein binding	IPI	16530705, 20224550, 21130043, 22939624, 23878260, 27991863, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	7898938
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8386825
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	10835628
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	7675451, 19779139
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	19779139
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	11532940
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7898938
GO:0019838	Function	Growth factor binding	IBA
GO:0019838	Function	Growth factor binding	IPI	9435229
GO:0019903	Function	Protein phosphatase binding	IPI	20826270
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	9435229
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	19779139
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IDA	23878260
GO:0042803	Function	Protein homodimerization activity	IDA	23878260
GO:0043066	Process	Negative regulation of apoptotic process	IMP	11532940
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	19779139
GO:0046330	Process	Positive regulation of JNK cascade	IMP	16076871
GO:0046777	Process	Protein autophosphorylation	IDA	7675451, 9435229, 23878260
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	9012504
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	11532940, 19779139
GO:0048286	Process	Lung alveolus development	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048514	Process	Blood vessel morphogenesis	ISS
GO:0060312	Process	Regulation of blood vessel remodeling	IEA
GO:0060312	Process	Regulation of blood vessel remodeling	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	11532940

MIM	HGNC	e!Ensembl
136352	3767	ENSG00000037280

P35916

Protein name

Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4)

Protein function

Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFC and VEGFD, and plays an essential role in adult lymphangiogenesis and in the development of the vascular network and the cardiovascular system during embryonic development. P

PDB

4BSJ , 4BSK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	231 → 314		Domain
PF13927	Ig_3	559 → 657		Domain
PF07679	I-set	678 → 765	Immunoglobulin I-set domain	Domain
PF17988	VEGFR-2_TMD	770 → 804	VEGFR-2 Transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	845 → 1169	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in endothelial cells (at protein level). Widely expressed. Detected in fetal spleen, lung and brain. Detected in adult liver, muscle, thymus, placenta, lung, testis, ovary, prostate, heart, and kidney. {ECO:0000269|PubMed:1327

Sequence

MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQ
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRR
RPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY

Sequence length

1363

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Focal adhesion Pathways in cancer Breast cancer		VEGF binds to VEGFR leading to receptor dimerization

180

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Capillary infantile hemangioma	Likely pathogenic	rs1762335528	RCV004796370
Congenital heart defects, multiple types, 7	Pathogenic; Likely pathogenic	rs2127839096, rs146006663, rs1415338572, rs2480880177, rs2480983963, rs1764039505, rs1422886839, rs755445139, rs1581616817, rs1581655293, rs1762335528	RCV001533291 RCV001706754 RCV002470578 RCV003986017 RCV004515783 RCV004555197 RCV001003426 RCV001003427 RCV001003429 RCV001003430 RCV004796370
FLT4-related disorder	Pathogenic; Likely pathogenic	rs2480883778, rs2480933426, rs2480922403, rs2127787560, rs2480869226, rs121909650, rs121909655, rs1451816005, rs1762335528	RCV003402389 RCV003421183 RCV003397862 RCV003392950 RCV003410866 RCV004751213 RCV003398529 RCV004751756 RCV003393877
Hereditary lymphedema type I	Likely pathogenic; Pathogenic	rs1761973773, rs121909650, rs2480842959, rs2480886920, rs2480884226, rs2480865554, rs267606818, rs121909651, rs121909652, rs121909653, rs121909654, rs121909655, rs121909656, rs587776833, rs1451816005, rs1762335528 View all (1 more)	RCV001331922 RCV003340475 RCV003154635 RCV003445406 RCV003445409 RCV003445410 RCV000017647 RCV000017648 RCV000017649 RCV000017650 RCV000017651 RCV000017653 RCV000017654 RCV000017655 RCV000017656 RCV000853321 RCV001199191
Non-immune hydrops fetalis	Likely pathogenic; Pathogenic	rs1451816005	RCV005359605

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Carcinoma of colon	Uncertain significance; Benign; Likely benign	rs796052110, rs796052111, rs56364366, rs796052112, rs796052113, rs796052114, rs796052109, rs796052097, rs796052098, rs751737827, rs796052099, rs796052100, rs796052101, rs796052102, rs796052103 View all (7 more)	RCV000186544 RCV000186545 RCV000186546 RCV000186547 RCV000186548 RCV000186549 RCV000186543 RCV000186530 RCV000186531 RCV000186532 RCV000186533 RCV000186534 RCV000186535 RCV000186536 RCV000186537 RCV000186538 RCV000186539 RCV000186540 RCV000186541 RCV000186542 RCV000987648 RCV000987647
Cervical cancer	Benign	rs34371546	RCV005906980
Clear cell carcinoma of kidney	Benign	rs34371546	RCV005906981
Colorectal cancer	Benign	rs34255532	RCV003323277
Familial pancreatic carcinoma	Benign	rs2242215	RCV005894349
Gastric cancer	Benign	rs34371546	RCV005906983
Hepatocellular carcinoma	Benign	rs2242215	RCV005894346
Lung cancer	Benign	rs307820, rs34371546	RCV005915567 RCV005906985
Lymphedema	Conflicting classifications of pathogenicity	rs773696166	RCV005626427
Lymphoma	Benign	rs2242215	RCV005894350
Nonpapillary renal cell carcinoma	Benign	rs2242215	RCV005894347
Ovarian cancer	Benign	rs2242215	RCV005894348
Ovarian serous cystadenocarcinoma	Benign	rs2242215	RCV005894351
Regorafenib response	drug response	rs1554115894	RCV000509019
Sarcoma	Benign	rs34371546	RCV005906982
Teratoma	Uncertain significance	rs777334601	RCV003221391
Thyroid cancer, nonmedullary, 1	Benign	rs34371546	RCV005906984
Uterine carcinosarcoma	Benign	rs2242215	RCV005894352
Uterine corpus endometrial carcinoma	Benign	rs34371546	RCV005906986

Show/Hide Text Mining Associations (118)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	10594750
Acute Kidney Injury	Associate	34112226
Adenocarcinoma of Lung	Associate	16116610, 17970036, 29048623, 34642306
Adrenal Insufficiency	Associate	23878260
Alzheimer Disease	Stimulate	31332262
Alzheimer Disease	Associate	36680854, 36905877
Atherosclerosis	Associate	14990597
Autistic Disorder	Associate	28991257
Autonomic Nervous System Diseases	Associate	34681005
Behcet Syndrome	Associate	34918882
Biliary Tract Neoplasms	Associate	25446376
Breast Neoplasms	Associate	10329591, 15901129, 25971960, 28791841, 30063723, 30947698, 34793664, 37779428
Calcinosis Cutis	Stimulate	30408085
Calcinosis Cutis	Associate	32665993
Carcinogenesis	Associate	22330345, 29137038
Carcinoma Adenoid Cystic	Associate	21423152
Carcinoma Hepatocellular	Associate	23737988, 28400300
Carcinoma Intraductal Noninfiltrating	Associate	15841074
Carcinoma Non Small Cell Lung	Associate	12518370, 16755294, 19216806, 19628565, 29995950, 30016964
Carcinoma Pancreatic Ductal	Associate	33213062
Carcinoma Renal Cell	Associate	23462807, 26821530, 27837630, 28754676, 30385613, 33668731
Carcinoma Squamous Cell	Associate	12518370, 27666723
Cholangiocarcinoma	Associate	20565817, 21492330, 30123080
Choriocarcinoma	Associate	26418280
Chylothorax	Associate	16419129
Clear cell metastatic renal cell carcinoma	Associate	30385613, 32665993
Cognition Disorders	Associate	31332262
Colorectal Neoplasms	Associate	23580180, 26917449, 27639612, 29162097, 36520636
Conotruncal cardiac defects	Associate	36789878
Coronary Artery Disease	Associate	29557990
Coronary Restenosis	Associate	29557990
COVID 19	Associate	34112226
Death	Stimulate	24040410
Death	Associate	33668731
Death Sudden	Associate	34328347
Drug Related Side Effects and Adverse Reactions	Associate	30385613
Endometrial Neoplasms	Associate	29348629
Fallopian Tube Diseases	Associate	30431105
Gastro enteropancreatic neuroendocrine tumor	Associate	29787601
Gastrointestinal Neoplasms	Associate	19755510
Gastrointestinal Stromal Tumors	Associate	21179485
Glioblastoma	Associate	22179774
Glioma	Associate	30278527
Granuloma Pyogenic	Associate	22955520
Heart Defects Congenital	Associate	28991257, 36205932, 36496429
Heart Diseases	Associate	32037394
Heart Failure	Associate	34328347
Hemangiosarcoma	Associate	20459536, 20949568
Hereditary renal agenesis	Associate	34681005
Hypomagnesemia primary	Associate	33668731
Hypoxia	Associate	23788753
Infections	Associate	15878864
Inflammation	Associate	39375631
Krukenberg Tumor	Stimulate	21574104
Leiomyosarcoma	Associate	25340839
Leukemia	Associate	11877295, 22251800
Leukemia Myeloid Acute	Associate	11877295, 36763100
Lymphangiectasia pulmonary congenital	Associate	9708800
Lymphangioleiomyomatosis	Associate	19717640, 33863980
Lymphangioma	Associate	11742043, 17584927
Lymphangiomyoma	Associate	20203284
Lymphangiosarcoma	Associate	20459536
Lymphatic Abnormalities	Associate	34681005
Lymphatic Diseases	Associate	18756043
Lymphatic Metastasis	Associate	12610509, 15107801, 16755294, 17970036, 18756043, 19589137, 19628565, 21912471, 22366442, 22502683, 23539643, 23737988, 24520214, 25446376, 26197772, 27666723 View all (1 more)
Lymphatic Metastasis	Stimulate	14760756, 24040410, 27639612, 29137038, 30123080
Lymphatic Vessel Tumors	Associate	10856194, 20004943, 20565772, 34681005
Lymphedema	Associate	10856194, 12740761, 16419129, 17458866, 18564920, 22351697, 22529953, 29896974, 30483911, 30582441, 34103024, 34681005
Lymphedema	Stimulate	30431105
Melanoma	Stimulate	11891198
Melanoma	Associate	20004943, 32618346
Melanoma Cutaneous Malignant	Associate	32618346
Mesothelioma Malignant	Associate	18008346
Nasopharyngeal Carcinoma	Associate	22366442
Neoplasm Metastasis	Associate	19628565, 21912471, 22330345, 22502683, 23878260, 24858271, 25009010, 26394830, 31200683, 33668731, 35586989
Neoplasms	Associate	10487612, 10594750, 10595926, 11330643, 11891198, 12610509, 14760756, 15107801, 15841074, 16116610, 16491267, 16755294, 16827121, 17659711, 17761831 View all (31 more)
Neoplasms	Stimulate	23539643, 32618346
Neoplasms	Inhibit	29162097
Neoplastic Syndromes Hereditary	Associate	29896974, 30947698
Neuroendocrine Tumors	Associate	26063633
Obesity	Associate	34890032
Oral Submucous Fibrosis	Associate	38050610
Osteosarcoma	Associate	21751203
Ovarian Hyperstimulation Syndrome	Associate	30483911
Ovarian Neoplasms	Associate	12610509, 15368324, 21574104, 26197772, 31200683
Pancreatic Neoplasms	Associate	20367641, 33213062
Papilloma	Associate	38193541
Peritonitis	Associate	12610509, 29896974
Pilomatrixoma	Stimulate	38350760
Prostatic Hyperplasia	Associate	11330643
Prostatic Neoplasms	Associate	16491267, 19436293, 24858271
Prostatitis	Associate	10390013, 15107801
Pterygium	Associate	22910845
Rectal Neoplasms	Associate	20680711
Recurrent respiratory papillomatosis	Associate	38193541
Sarcoma Ewing	Associate	26739507
Sarcoma Kaposi	Associate	10594750, 19260835, 37740179
Sebaceous Gland Neoplasms	Associate	31612234
Sjogren's Syndrome	Associate	26828975
Solitary Fibrous Tumors	Associate	40660115
Squamous Cell Carcinoma of Head and Neck	Associate	22502683, 24040410, 25612142, 27666723, 28718364, 38050610
Stomach Neoplasms	Associate	14760756, 17659711, 18756043, 19068081, 23539643
Stomach Neoplasms	Stimulate	21912471
Stomach Neoplasms	Inhibit	22791956
Synovitis	Associate	25889955
Tarlov Cysts	Stimulate	21912471
Tertiary Lymphoid Structures	Stimulate	21912471, 29137038
Tertiary Lymphoid Structures	Associate	22502683
Tetralogy of Fallot	Associate	28991257, 30232381, 30582441, 34328347
Thymic epithelial tumor	Associate	24908332
Thymoma	Associate	26254278
Thymus Neoplasms	Associate	26254278
Triple Negative Breast Neoplasms	Associate	28607365, 36835014
Tuberous Sclerosis	Associate	21767323
Urinary Bladder Neoplasms	Associate	33238953
Uterine Cervical Neoplasms	Associate	19589137, 32899940
Vasospasm Intracranial	Associate	25082408
Ventricular Dysfunction Left	Associate	39375631

FLT4 (fms related receptor tyrosine kinase 4)