Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23239
Gene name	PH domain and leucine rich repeat protein phosphatase 1
Gene symbol	PHLPP1
Synonyms (NCBI Gene)	PHLPPPLEKHE1PPM3ASCOP
Chromosome	18
Chromosome location	18q21.33
Summary	This gene encodes a member of the serine/threonine phosphatase family. The encoded protein promotes apoptosis by dephosphorylating and inactivating the serine/threonine kinase Akt, and functions as a tumor suppressor in multiple types of cancer. Increased

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019235	hsa-miR-331-3p	Sequencing	20371350
MIRT021082	hsa-miR-190a-5p	Reporter assay;Western blot	21750348
MIRT041846	hsa-miR-484	CLASH	23622248
MIRT037351	hsa-miR-877-5p	CLASH	23622248
MIRT035820	hsa-miR-1307-3p	CLASH	23622248
MIRT052967	hsa-miR-17-5p	ImmunoblotLuciferase reporter assay	22116552
MIRT052968	hsa-miR-18a-5p	ImmunoblotLuciferase reporter assay	22116552
MIRT052969	hsa-miR-19a-3p	ImmunoblotLuciferase reporter assay	22116552
MIRT052970	hsa-miR-92a-3p	ImmunoblotLuciferase reporter assay	22116552
MIRT019235	hsa-miR-331-3p	Luciferase reporter assay	24825302
MIRT053250	hsa-miR-224-5p	ImmunoprecipitaionLuciferase reporter assayWestern blot	23846336
MIRT053250	hsa-miR-224-5p	ImmunoprecipitaionLuciferase reporter assayWestern blot	23846336
MIRT053250	hsa-miR-224-5p	ImmunoprecipitaionLuciferase reporter assayWestern blot	23846336
MIRT053250	hsa-miR-224-5p	ImmunoprecipitaionLuciferase reporter assayWestern blot	23846336
MIRT054811	hsa-miR-141-3p	Luciferase reporter assayqRT-PCR	24945731
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT021082	hsa-miR-190a-5p	qRT-PCRLuciferase reporter assayWestern blot	23396362
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438165	hsa-miR-200b-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438164	hsa-miR-375	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT438163	hsa-miR-15a-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	24337069
MIRT021082	hsa-miR-190a-5p	qRT-PCRLuciferase reporter assayWestern blot	23396362
MIRT644106	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT644105	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT535293	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT535292	hsa-miR-4422	PAR-CLIP	22012620
MIRT535291	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT535290	hsa-miR-5688	PAR-CLIP	22012620
MIRT535289	hsa-miR-7-1-3p	PAR-CLIP	22012620
MIRT535288	hsa-miR-7-2-3p	PAR-CLIP	22012620
MIRT199173	hsa-miR-4495	PAR-CLIP	22012620
MIRT199172	hsa-miR-1279	PAR-CLIP	22012620
MIRT535287	hsa-miR-7112-3p	PAR-CLIP	22012620
MIRT053250	hsa-miR-224-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26245343
MIRT053250	hsa-miR-224-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26245343
MIRT644106	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT644105	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT535293	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT535292	hsa-miR-4422	PAR-CLIP	22012620
MIRT535291	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT535290	hsa-miR-5688	PAR-CLIP	22012620
MIRT535289	hsa-miR-7-1-3p	PAR-CLIP	22012620
MIRT535288	hsa-miR-7-2-3p	PAR-CLIP	22012620
MIRT199173	hsa-miR-4495	PAR-CLIP	22012620
MIRT199172	hsa-miR-1279	PAR-CLIP	22012620
MIRT535287	hsa-miR-7112-3p	PAR-CLIP	22012620
MIRT1232119	hsa-miR-299-5p	CLIP-seq
MIRT1232120	hsa-miR-548aa	CLIP-seq
MIRT1232121	hsa-miR-548n	CLIP-seq
MIRT1232122	hsa-miR-548t	CLIP-seq
MIRT1552301	hsa-miR-1273e	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT1552303	hsa-miR-496	CLIP-seq
MIRT2068132	hsa-miR-1184	CLIP-seq
MIRT2068133	hsa-miR-1265	CLIP-seq
MIRT2068134	hsa-miR-1283	CLIP-seq
MIRT2068135	hsa-miR-1301	CLIP-seq
MIRT2068136	hsa-miR-141	CLIP-seq
MIRT2068137	hsa-miR-200a	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT2068138	hsa-miR-4418	CLIP-seq
MIRT2068139	hsa-miR-4491	CLIP-seq
MIRT2068140	hsa-miR-4657	CLIP-seq
MIRT2068141	hsa-miR-4660	CLIP-seq
MIRT2068142	hsa-miR-4723-5p	CLIP-seq
MIRT2068143	hsa-miR-4764-5p	CLIP-seq
MIRT2068144	hsa-miR-4768-5p	CLIP-seq
MIRT2068145	hsa-miR-5047	CLIP-seq
MIRT2068146	hsa-miR-509-3-5p	CLIP-seq
MIRT2068147	hsa-miR-509-5p	CLIP-seq
MIRT2068148	hsa-miR-610	CLIP-seq
MIRT2068132	hsa-miR-1184	CLIP-seq
MIRT1552301	hsa-miR-1273e	CLIP-seq
MIRT2068134	hsa-miR-1283	CLIP-seq
MIRT2295473	hsa-miR-1284	CLIP-seq
MIRT2068135	hsa-miR-1301	CLIP-seq
MIRT2068136	hsa-miR-141	CLIP-seq
MIRT2068137	hsa-miR-200a	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT2295474	hsa-miR-219-5p	CLIP-seq
MIRT2295475	hsa-miR-300	CLIP-seq
MIRT2295476	hsa-miR-3156-5p	CLIP-seq
MIRT2295477	hsa-miR-323-3p	CLIP-seq
MIRT2295478	hsa-miR-326	CLIP-seq
MIRT2295479	hsa-miR-330-5p	CLIP-seq
MIRT2295480	hsa-miR-3616-5p	CLIP-seq
MIRT2295481	hsa-miR-3647-5p	CLIP-seq
MIRT2295482	hsa-miR-3688-3p	CLIP-seq
MIRT2295483	hsa-miR-380	CLIP-seq
MIRT2295484	hsa-miR-381	CLIP-seq
MIRT2295485	hsa-miR-4273	CLIP-seq
MIRT2295486	hsa-miR-4276	CLIP-seq
MIRT2295487	hsa-miR-4445	CLIP-seq
MIRT2295488	hsa-miR-452	CLIP-seq
MIRT2068141	hsa-miR-4660	CLIP-seq
MIRT2295489	hsa-miR-4666-3p	CLIP-seq
MIRT2295490	hsa-miR-4676-3p	CLIP-seq
MIRT2295491	hsa-miR-4699-3p	CLIP-seq
MIRT2068144	hsa-miR-4768-5p	CLIP-seq
MIRT2295492	hsa-miR-4782-3p	CLIP-seq
MIRT2295493	hsa-miR-4795-5p	CLIP-seq
MIRT1552303	hsa-miR-496	CLIP-seq
MIRT2068145	hsa-miR-5047	CLIP-seq
MIRT2295494	hsa-miR-508-3p	CLIP-seq
MIRT1232121	hsa-miR-548n	CLIP-seq
MIRT1232122	hsa-miR-548t	CLIP-seq
MIRT2295495	hsa-miR-573	CLIP-seq
MIRT2068148	hsa-miR-610	CLIP-seq
MIRT2295496	hsa-miR-618	CLIP-seq
MIRT2295497	hsa-miR-767-3p	CLIP-seq
MIRT2068132	hsa-miR-1184	CLIP-seq
MIRT2593141	hsa-miR-1294	CLIP-seq
MIRT2068135	hsa-miR-1301	CLIP-seq
MIRT2068136	hsa-miR-141	CLIP-seq
MIRT2593142	hsa-miR-1827	CLIP-seq
MIRT2068137	hsa-miR-200a	CLIP-seq
MIRT1552302	hsa-miR-2113	CLIP-seq
MIRT2593143	hsa-miR-219-1-3p	CLIP-seq
MIRT2593144	hsa-miR-3155	CLIP-seq
MIRT2593145	hsa-miR-3155b	CLIP-seq
MIRT2295480	hsa-miR-3616-5p	CLIP-seq
MIRT2295481	hsa-miR-3647-5p	CLIP-seq
MIRT2593146	hsa-miR-425	CLIP-seq
MIRT2295486	hsa-miR-4276	CLIP-seq
MIRT2593147	hsa-miR-4316	CLIP-seq
MIRT2068138	hsa-miR-4418	CLIP-seq
MIRT2593148	hsa-miR-4514	CLIP-seq
MIRT2068141	hsa-miR-4660	CLIP-seq
MIRT2593149	hsa-miR-4692	CLIP-seq
MIRT2295493	hsa-miR-4795-5p	CLIP-seq
MIRT2068145	hsa-miR-5047	CLIP-seq
MIRT2068146	hsa-miR-509-3-5p	CLIP-seq
MIRT2068147	hsa-miR-509-5p	CLIP-seq
MIRT2593150	hsa-miR-571	CLIP-seq
MIRT2295495	hsa-miR-573	CLIP-seq
MIRT2295497	hsa-miR-767-3p	CLIP-seq
MIRT2593151	hsa-miR-940	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002667	Process	Regulation of T cell anergy	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	28147277
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	18162466, 19615732, 21701506, 21804599, 24145035, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	28147277
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0009649	Process	Entrainment of circadian clock	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042981	Process	Regulation of apoptotic process	IDA	20513427
GO:0043408	Process	Regulation of MAPK cascade	IMP	24530606
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0046328	Process	Regulation of JNK cascade	IDA	17386267
GO:0046872	Function	Metal ion binding	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	17386267
GO:1900744	Process	Regulation of p38MAPK cascade	IDA	17386267

MIM	HGNC	e!Ensembl
609396	20610	ENSG00000081913

O60346

Protein name

PH domain leucine-rich repeat-containing protein phosphatase 1 (EC 3.1.3.16) (Pleckstrin homology domain-containing family E member 1) (PH domain-containing family E member 1) (Suprachiasmatic nucleus circadian oscillatory protein) (hSCOP)

Protein function

Protein phosphatase involved in regulation of Akt and PKC signaling. Mediates dephosphorylation in the C-terminal domain hydrophobic motif of members of the AGC Ser/Thr protein kinase family; specifically acts on 'Ser-473' of AKT2 and AKT3, 'Ser

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	537 → 636	PH domain	Domain
PF13516	LRR_6	691 → 705	Leucine Rich repeat	Repeat
PF13855	LRR_8	714 → 772	Leucine rich repeat	Repeat
PF13516	LRR_6	829 → 849	Leucine Rich repeat	Repeat
PF00481	PP2C	1174 → 1415	Protein phosphatase 2C	Family

Tissue specificity

TISSUE SPECIFICITY: In colorectal cancer tissue, expression is highest in the surface epithelium of normal colonic mucosa adjacent to the cancer tissue but is largely excluded from the crypt bases. Expression is lost or significantly decreased in 78% of t

Sequence

MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAP
SGGNGSGSGAREEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLL
LRRGRLKRNLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLK
HRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHK
GGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSEVPPARSAPGAFGGPPRAPPA
DLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESFSLSPSAESVS
DRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAP
RAIDSPGGAVREGSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETT
RRLEAEEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLS
GMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQH
CLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQ
DLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELN
VSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFNEFTDIPEVLE
KLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRD
NKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMD
VSRNRLENVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLARLPERLE
RTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLT
NNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIM
NCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPR
LVLDHKTLELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCD
NREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQK
LGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIK
QHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSL
SVEEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAV
PPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISSELSTSEMSSEVGSTASDEPPP
GALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNG
SRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGR
RRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKH
HQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTPL

Sequence length

1717

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway		Negative regulation of the PI3K/AKT network

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Attention deficit hyperactivity disorder	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal impaired awareness seizure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL ONSET IMPAIRED AWARENESS EPILEPTIC SEIZURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	28139510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	26463718	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	21177869, 31178227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	21840483	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	21750348	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	26760962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	22183558	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Associate	26823799	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	15808505, 19797085, 24061475	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	21177869, 24145035, 29194591, 34663797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Stimulate	33920886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	22183558	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	26245343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Inhibit	15808505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	21804599	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Inhibit	24061475	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	19261608	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	26463718, 33029497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	25793736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Inhibit	28139510, 34982011	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	36781840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	25793736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	31178227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	15808505, 19797085, 21177869, 21840483, 22340730, 24061475, 25793736, 26868909, 28139510, 32680567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21804599, 21821012, 21840483, 22183558, 24145035, 24928944, 26463718, 30904392, 32294598, 34663797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	28139510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	26760962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	38184561	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	21840483	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Inhibit	22340730	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Inhibit	21840483	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Inhibit	28139510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	25793736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34982011	★★★★★ ★☆☆☆☆ Found in Text Mining only

PHLPP1 (PH domain and leucine rich repeat protein phosphatase 1)