Gene Gene information from NCBI Gene database.
Entrez ID 23237
Gene name Activity regulated cytoskeleton associated protein
Gene symbol ARC
Synonyms (NCBI Gene)
Arg3.1hArc
Chromosome 8
Chromosome location 8q24.3
miRNA miRNA information provided by mirtarbase database.
191
miRTarBase ID miRNA Experiments Reference
MIRT043974 hsa-miR-378a-5p CLASH 23622248
MIRT053767 hsa-miR-185-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 24763054
MIRT053767 hsa-miR-185-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 24763054
MIRT053767 hsa-miR-185-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 24763054
MIRT053767 hsa-miR-185-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 24763054
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
61
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IDA 33175445
GO:0003729 Function MRNA binding IEA
GO:0003729 Function MRNA binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612461 648 ENSG00000198576
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7LC44
Protein name Activity-regulated cytoskeleton-associated protein (hArc) (Activity-regulated gene 3.1 protein homolog) (ARC/ARG3.1) (Arg3.1)
Protein function Master regulator of synaptic plasticity that self-assembles into virion-like capsids that encapsulate RNAs and mediate intercellular RNA transfer in the nervous system. ARC protein is released from neurons in extracellular vesicles that mediate
PDB 6TN7 , 6TNQ , 6TQ0 , 6YTU , 7R1Z , 7R23 , 8QF4 , 8QF5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18162 Arc_C 278 360 Arc C-lobe Domain
Sequence
MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE

QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE
Sequence length 396
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Amphetamine addiction   NGF-stimulated transcription