Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23237
Gene name Gene Name - the full gene name approved by the HGNC.
Activity regulated cytoskeleton associated protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARC
Synonyms (NCBI Gene) Gene synonyms aliases
Arg3.1, hArc
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043974 hsa-miR-378a-5p CLASH 23622248
MIRT053767 hsa-miR-185-5p Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot 24763054
MIRT053767 hsa-miR-185-5p Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot 24763054
MIRT053767 hsa-miR-185-5p Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot 24763054
MIRT053767 hsa-miR-185-5p Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot 24763054
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0003729 Function MRNA binding ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005737 Component Cytoplasm IDA 21834987
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612461 648 ENSG00000198576
Protein
UniProt ID Q7LC44
Protein name Activity-regulated cytoskeleton-associated protein (hArc) (Activity-regulated gene 3.1 protein homolog) (ARC/ARG3.1) (Arg3.1)
Protein function Master regulator of synaptic plasticity that self-assembles into virion-like capsids that encapsulate RNAs and mediate intercellular RNA transfer in the nervous system. ARC protein is released from neurons in extracellular vesicles that mediate
PDB 6TN7 , 6TNQ , 6TQ0 , 6YTU , 7R1Z , 7R23 , 8QF4 , 8QF5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18162 Arc_C 278 360 Arc C-lobe Domain
Sequence
MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE

QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE
Sequence length 396
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Amphetamine addiction   NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
18503570
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
22083728
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Psoriatic Associate 33568645
Arthritis Rheumatoid Associate 33568645
Carcinoma Hepatocellular Associate 28732507
Carcinoma Renal Cell Associate 28464919
Depressive Disorder Associate 35665606
Epilepsy Associate 27966542, 35665606
Glioma Associate 33969375
Inflammation Associate 33568645
Mental Retardation Autosomal Recessive 1 Associate 28671113
Neuroblastoma Associate 26817842