RRS1 (regulator of ribosome synthesis 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23212
Gene name Gene Name - the full gene name approved by the HGNC.
Regulator of ribosome synthesis 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RRS1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q13.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(63)
miRTarBase ID miRNA Experiments Reference
MIRT016031 hsa-miR-374b-5p Sequencing 20371350
MIRT029717 hsa-miR-26b-5p Microarray 19088304
MIRT041840 hsa-miR-484 CLASH 23622248
MIRT040785 hsa-miR-18a-3p CLASH 23622248
MIRT106165 hsa-miR-944 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0000027 Process Ribosomal large subunit assembly IMP 24120868
GO:0000055 Process Ribosomal large subunit export from nucleus IBA 21873635
GO:0000447 Process Endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA 21873635
GO:0000794 Component Condensed nuclear chromosome IDA 19465021
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618311 17083 ENSG00000179041
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q15050
Protein name Ribosome biogenesis regulatory protein homolog
Protein function Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.
PDB 8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FL0 , 8IR1 , 8IR3 , 8RL2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04939 RRS1 31 → 193 Ribosome biogenesis regulatory protein (RRS1) Family
Sequence 
MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAE
LQALARDNTQLLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARL
KGIRPKKKTNLVWDEVSGQWRRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKE
RVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLP
KEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKPQLDVTRATNKQMREEDQEEA
AKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLGGKRKGGQRPG
GKRRK
Sequence length 365
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)		 27602772
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Bipolar Disorder Bipolar Disorder GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Show/Hide Text Mining Associations (16)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37705317
Azoospermia Associate 36945018
Breast Neoplasms Associate 35179222, 37049702
Carcinoma Hepatocellular Associate 28849112, 34433556, 37705317
Carcinoma Renal Cell Associate 37705317
Cardiomyopathies Associate 32631246
Head and Neck Neoplasms Associate 37705317
Liver Neoplasms Associate 37705317
Neoplasm Metastasis Associate 35179222
Neoplasms Associate 28849112, 33204686, 35163645, 37049702, 37090698