Gene Gene information from NCBI Gene database.
Entrez ID 23212
Gene name Regulator of ribosome synthesis 1
Gene symbol RRS1
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q13.1
miRNA miRNA information provided by mirtarbase database.
63
miRTarBase ID miRNA Experiments Reference
MIRT016031 hsa-miR-374b-5p Sequencing 20371350
MIRT029717 hsa-miR-26b-5p Microarray 19088304
MIRT041840 hsa-miR-484 CLASH 23622248
MIRT040785 hsa-miR-18a-3p CLASH 23622248
MIRT106165 hsa-miR-944 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000027 Process Ribosomal large subunit assembly IMP 24120868
GO:0000447 Process Endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA
GO:0000794 Component Condensed nuclear chromosome IDA 19465021
GO:0002244 Process Hematopoietic progenitor cell differentiation IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618311 17083 ENSG00000179041
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15050
Protein name Ribosome biogenesis regulatory protein homolog
Protein function Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.
PDB 8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FL0 , 8IR1 , 8IR3 , 8RL2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04939 RRS1 31 193 Ribosome biogenesis regulatory protein (RRS1) Family
Sequence
MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAE
LQALARDNTQLLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARL
KGIRPKKKTNLVWDEVSGQWRRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKE
RVAKNELNRLRNL
ARAHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLP
KEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKPQLDVTRATNKQMREEDQEEA
AKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLGGKRKGGQRPG
GKRRK
Sequence length 365
Interactions View interactions