Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23212
Gene name Gene Name - the full gene name approved by the HGNC.	Regulator of ribosome synthesis 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RRS1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q13.1

Show/Hide all(63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016031	hsa-miR-374b-5p	Sequencing	20371350
MIRT029717	hsa-miR-26b-5p	Microarray	19088304
MIRT041840	hsa-miR-484	CLASH	23622248
MIRT040785	hsa-miR-18a-3p	CLASH	23622248
MIRT106165	hsa-miR-944	PAR-CLIP	20371350
MIRT106168	hsa-miR-4783-3p	PAR-CLIP	20371350
MIRT106172	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT571217	hsa-miR-6883-3p	PAR-CLIP	20371350
MIRT571215	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT571216	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT571214	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT571213	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT563888	hsa-miR-4687-3p	PAR-CLIP	20371350
MIRT106174	hsa-miR-132-3p	PAR-CLIP	21572407
MIRT106173	hsa-miR-212-3p	PAR-CLIP	21572407
MIRT554542	hsa-miR-4272	PAR-CLIP	21572407
MIRT554543	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT554541	hsa-miR-6500-3p	PAR-CLIP	21572407
MIRT106177	hsa-miR-4704-3p	PAR-CLIP	21572407
MIRT554540	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT554539	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT106178	hsa-miR-4774-3p	PAR-CLIP	21572407
MIRT106165	hsa-miR-944	PAR-CLIP	20371350
MIRT106168	hsa-miR-4783-3p	PAR-CLIP	20371350
MIRT106172	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT571217	hsa-miR-6883-3p	PAR-CLIP	20371350
MIRT571215	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT571216	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT571214	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT571213	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT563888	hsa-miR-4687-3p	PAR-CLIP	20371350
MIRT106174	hsa-miR-132-3p	PAR-CLIP	21572407
MIRT106173	hsa-miR-212-3p	PAR-CLIP	21572407
MIRT554542	hsa-miR-4272	PAR-CLIP	21572407
MIRT554543	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT554541	hsa-miR-6500-3p	PAR-CLIP	21572407
MIRT106177	hsa-miR-4704-3p	PAR-CLIP	21572407
MIRT554540	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT554539	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT106178	hsa-miR-4774-3p	PAR-CLIP	21572407
MIRT1320770	hsa-miR-1264	CLIP-seq
MIRT1320771	hsa-miR-204	CLIP-seq
MIRT1320772	hsa-miR-211	CLIP-seq
MIRT1320773	hsa-miR-3202	CLIP-seq
MIRT1320774	hsa-miR-3921	CLIP-seq
MIRT1320775	hsa-miR-3926	CLIP-seq
MIRT1320776	hsa-miR-4421	CLIP-seq
MIRT1320777	hsa-miR-4653-5p	CLIP-seq
MIRT1320778	hsa-miR-4766-5p	CLIP-seq
MIRT1320779	hsa-miR-548s	CLIP-seq
MIRT1320780	hsa-miR-593	CLIP-seq
MIRT1320781	hsa-miR-598	CLIP-seq
MIRT1320782	hsa-miR-618	CLIP-seq
MIRT2095237	hsa-miR-2113	CLIP-seq
MIRT2095238	hsa-miR-4775	CLIP-seq
MIRT2319590	hsa-miR-1237	CLIP-seq
MIRT2319591	hsa-miR-1248	CLIP-seq
MIRT2319592	hsa-miR-299-5p	CLIP-seq
MIRT2319593	hsa-miR-3714	CLIP-seq
MIRT2319594	hsa-miR-4303	CLIP-seq
MIRT2319595	hsa-miR-4493	CLIP-seq
MIRT2319596	hsa-miR-885-3p	CLIP-seq
MIRT2458644	hsa-miR-3692	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000027	Process	Ribosomal large subunit assembly	IMP	24120868
GO:0000447	Process	Endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0000794	Component	Condensed nuclear chromosome	IDA	19465021
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28514442, 30021884, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	19465021
GO:0005730	Component	Nucleolus	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	19465021
GO:0008097	Function	5S rRNA binding	IDA	24120868
GO:0030687	Component	Preribosome, large subunit precursor	IBA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042273	Process	Ribosomal large subunit biogenesis	IBA
GO:0042273	Process	Ribosomal large subunit biogenesis	IMP	24120868
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IMP	24120868
GO:1902570	Process	Protein localization to nucleolus	IMP	24120868

MIM	HGNC	e!Ensembl
618311	17083	ENSG00000179041

Protein

UniProt ID

Q15050

Protein name

Ribosome biogenesis regulatory protein homolog

Protein function

Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.

PDB

8FKP , 8FKQ , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FL0 , 8IR1 , 8IR3 , 8RL2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04939	RRS1	31 → 193	Ribosome biogenesis regulatory protein (RRS1)	Family

Sequence

MEGQSVEELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAE
LQALARDNTQLLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARL
KGIRPKKKTNLVWDEVSGQWRRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKE
RVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLP
KEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKPQLDVTRATNKQMREEDQEEA
AKRRKMSQKGKRKGGRQGPGGKRKGGPPSQGGKRKGGLGGKMNSGPPGLGGKRKGGQRPG
GKRRK

Sequence length

365

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder, Bipolar I disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37705317
Azoospermia	Associate	36945018
Breast Neoplasms	Associate	35179222, 37049702
Carcinoma Hepatocellular	Associate	28849112, 34433556, 37705317
Carcinoma Renal Cell	Associate	37705317
Cardiomyopathies	Associate	32631246
Head and Neck Neoplasms	Associate	37705317
Liver Neoplasms	Associate	37705317
Neoplasm Metastasis	Associate	35179222
Neoplasms	Associate	28849112, 33204686, 35163645, 37049702, 37090698
Neoplasms	Stimulate	37705317
Ovarian Neoplasms	Associate	35163645
Retinoblastoma	Stimulate	33204686
Stomach Neoplasms	Associate	31438772
Stroke	Associate	37090698
Uterine Cervical Neoplasms	Associate	30910849

RRS1 (regulator of ribosome synthesis 1)