Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2321
Gene name Gene Name - the full gene name approved by the HGNC.	Fms related receptor tyrosine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FLT1
Synonyms (NCBI Gene) Gene synonyms aliases	FLT, FLT-1, VEGFR-1, VEGFR1
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a tra

Show/Hide all(317)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006441	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006441	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006441	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT006850	hsa-miR-100-5p	Luciferase reporter assay	22955733
MIRT006850	hsa-miR-100-5p	Luciferase reporter assay	22955733
MIRT006885	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT020776	hsa-miR-155-5p	qRT-PCR	21310411
MIRT006885	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22735571
MIRT608058	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT608058	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23313552
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608058	hsa-miR-8485	HITS-CLIP	24906430
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	24906430
MIRT608056	hsa-miR-935	HITS-CLIP	24906430
MIRT608055	hsa-miR-582-5p	HITS-CLIP	24906430
MIRT443671	hsa-miR-371b-3p	PAR-CLIP	22100165
MIRT443670	hsa-miR-371a-3p	PAR-CLIP	22100165
MIRT443669	hsa-miR-33b-3p	PAR-CLIP	22100165
MIRT443668	hsa-miR-515-3p	PAR-CLIP	22100165
MIRT443667	hsa-miR-519e-3p	PAR-CLIP	22100165
MIRT443666	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT443664	hsa-miR-4671-3p	PAR-CLIP	22100165
MIRT443665	hsa-miR-4473	PAR-CLIP	22100165
MIRT443663	hsa-miR-6844	PAR-CLIP	22100165
MIRT006441	hsa-miR-200b-3p	Western blot	27373709
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT575422	hsa-miR-8485	HITS-CLIP	27418678
MIRT735012	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, In situ hybridization, Flow cytometry	33093438
MIRT575422	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT575422	hsa-miR-8485	HITS-CLIP	23313552
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT608056	hsa-miR-935	HITS-CLIP	23313552
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23313552
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608056	hsa-miR-935	HITS-CLIP	23824327
MIRT608055	hsa-miR-582-5p	HITS-CLIP	23824327
MIRT575422	hsa-miR-8485	HITS-CLIP	23824327
MIRT608057	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT443671	hsa-miR-371b-3p	PAR-CLIP	22100165
MIRT443670	hsa-miR-371a-3p	PAR-CLIP	22100165
MIRT443669	hsa-miR-33b-3p	PAR-CLIP	22100165
MIRT443668	hsa-miR-515-3p	PAR-CLIP	22100165
MIRT443667	hsa-miR-519e-3p	PAR-CLIP	22100165
MIRT443666	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT443664	hsa-miR-4671-3p	PAR-CLIP	22100165
MIRT443665	hsa-miR-4473	PAR-CLIP	22100165
MIRT443663	hsa-miR-6844	PAR-CLIP	22100165
MIRT999025	hsa-miR-1470	CLIP-seq
MIRT999026	hsa-miR-148a	CLIP-seq
MIRT999027	hsa-miR-148b	CLIP-seq
MIRT999028	hsa-miR-152	CLIP-seq
MIRT999029	hsa-miR-1909	CLIP-seq
MIRT999030	hsa-miR-200b	CLIP-seq
MIRT999031	hsa-miR-200c	CLIP-seq
MIRT999032	hsa-miR-224	CLIP-seq
MIRT999033	hsa-miR-2682	CLIP-seq
MIRT999034	hsa-miR-3121-3p	CLIP-seq
MIRT999035	hsa-miR-34a	CLIP-seq
MIRT999036	hsa-miR-34c-5p	CLIP-seq
MIRT999037	hsa-miR-3688-3p	CLIP-seq
MIRT999038	hsa-miR-3714	CLIP-seq
MIRT999039	hsa-miR-3919	CLIP-seq
MIRT999040	hsa-miR-429	CLIP-seq
MIRT999041	hsa-miR-449a	CLIP-seq
MIRT999042	hsa-miR-449b	CLIP-seq
MIRT999043	hsa-miR-449c	CLIP-seq
MIRT999044	hsa-miR-4691-5p	CLIP-seq
MIRT999045	hsa-miR-4713-3p	CLIP-seq
MIRT999046	hsa-miR-4713-5p	CLIP-seq
MIRT999047	hsa-miR-491-3p	CLIP-seq
MIRT999048	hsa-miR-1307	CLIP-seq
MIRT999049	hsa-miR-4638-5p	CLIP-seq
MIRT999050	hsa-miR-4772-3p	CLIP-seq
MIRT999030	hsa-miR-200b	CLIP-seq
MIRT999031	hsa-miR-200c	CLIP-seq
MIRT999051	hsa-miR-30a	CLIP-seq
MIRT999052	hsa-miR-30b	CLIP-seq
MIRT999053	hsa-miR-30c	CLIP-seq
MIRT999054	hsa-miR-30d	CLIP-seq
MIRT999055	hsa-miR-30e	CLIP-seq
MIRT999056	hsa-miR-33a	CLIP-seq
MIRT999057	hsa-miR-33b	CLIP-seq
MIRT999058	hsa-miR-369-3p	CLIP-seq
MIRT999059	hsa-miR-4265	CLIP-seq
MIRT999040	hsa-miR-429	CLIP-seq
MIRT999060	hsa-miR-4296	CLIP-seq
MIRT999061	hsa-miR-4322	CLIP-seq
MIRT999062	hsa-miR-578	CLIP-seq
MIRT999063	hsa-miR-581	CLIP-seq
MIRT999064	hsa-miR-586	CLIP-seq
MIRT1996042	hsa-miR-4279	CLIP-seq
MIRT1996043	hsa-miR-1178	CLIP-seq
MIRT1996044	hsa-miR-1245	CLIP-seq
MIRT1996045	hsa-miR-136	CLIP-seq
MIRT1996046	hsa-miR-1972	CLIP-seq
MIRT1996047	hsa-miR-3194-5p	CLIP-seq
MIRT1996048	hsa-miR-4650-5p	CLIP-seq
MIRT1996049	hsa-miR-4676-5p	CLIP-seq
MIRT1996050	hsa-miR-575	CLIP-seq
MIRT999025	hsa-miR-1470	CLIP-seq
MIRT2230109	hsa-miR-3120-3p	CLIP-seq
MIRT2230110	hsa-miR-3124-3p	CLIP-seq
MIRT2230111	hsa-miR-4276	CLIP-seq
MIRT2230112	hsa-miR-4302	CLIP-seq
MIRT999046	hsa-miR-4713-5p	CLIP-seq
MIRT2230113	hsa-miR-4756-3p	CLIP-seq
MIRT2230114	hsa-miR-548t	CLIP-seq
MIRT2230115	hsa-miR-595	CLIP-seq
MIRT2230116	hsa-miR-648	CLIP-seq
MIRT2388020	hsa-miR-4780	CLIP-seq
MIRT2388021	hsa-miR-623	CLIP-seq
MIRT2449782	hsa-miR-1254	CLIP-seq
MIRT2449783	hsa-miR-1272	CLIP-seq
MIRT2449784	hsa-miR-1297	CLIP-seq
MIRT2449785	hsa-miR-1322	CLIP-seq
MIRT2449786	hsa-miR-1343	CLIP-seq
MIRT2449787	hsa-miR-1976	CLIP-seq
MIRT2449788	hsa-miR-26a	CLIP-seq
MIRT2449789	hsa-miR-26b	CLIP-seq
MIRT2449790	hsa-miR-3116	CLIP-seq
MIRT2449791	hsa-miR-3149	CLIP-seq
MIRT739478	hsa-miR-3682-3p	CLIP-seq
MIRT1996042	hsa-miR-4279	CLIP-seq
MIRT2449792	hsa-miR-4421	CLIP-seq
MIRT2449793	hsa-miR-4465	CLIP-seq
MIRT2449794	hsa-miR-4735-5p	CLIP-seq
MIRT2449795	hsa-miR-4740-3p	CLIP-seq
MIRT2449796	hsa-miR-4775	CLIP-seq
MIRT2449797	hsa-miR-4794	CLIP-seq
MIRT2449798	hsa-miR-590-3p	CLIP-seq
MIRT2449799	hsa-miR-661	CLIP-seq
MIRT2533954	hsa-miR-122	CLIP-seq
MIRT2449782	hsa-miR-1254	CLIP-seq
MIRT2449783	hsa-miR-1272	CLIP-seq
MIRT2533955	hsa-miR-139-3p	CLIP-seq
MIRT2449790	hsa-miR-3116	CLIP-seq
MIRT2533956	hsa-miR-3135b	CLIP-seq
MIRT2449791	hsa-miR-3149	CLIP-seq
MIRT2533957	hsa-miR-3652	CLIP-seq
MIRT739478	hsa-miR-3682-3p	CLIP-seq
MIRT2533958	hsa-miR-4423-5p	CLIP-seq
MIRT2533959	hsa-miR-4430	CLIP-seq
MIRT2449794	hsa-miR-4735-5p	CLIP-seq
MIRT2449796	hsa-miR-4775	CLIP-seq
MIRT2449797	hsa-miR-4794	CLIP-seq
MIRT2449798	hsa-miR-590-3p	CLIP-seq
MIRT2533960	hsa-miR-633	CLIP-seq
MIRT2449799	hsa-miR-661	CLIP-seq
MIRT2449782	hsa-miR-1254	CLIP-seq
MIRT2449790	hsa-miR-3116	CLIP-seq
MIRT2449791	hsa-miR-3149	CLIP-seq
MIRT2681048	hsa-miR-4312	CLIP-seq
MIRT2449794	hsa-miR-4735-5p	CLIP-seq
MIRT2449796	hsa-miR-4775	CLIP-seq
MIRT2449797	hsa-miR-4794	CLIP-seq
MIRT2449798	hsa-miR-590-3p	CLIP-seq
MIRT2533960	hsa-miR-633	CLIP-seq
MIRT2449799	hsa-miR-661	CLIP-seq

Transcription factors

Show/Hide all(9)

Transcription factor	Regulation	Reference
ATF1	Unknown	7499271
CREB1	Unknown	7499271
E2F1	Unknown	20516113
EGR1	Unknown	10828020
EPAS1	Activation	15192019;19616846
ESR1	Unknown	17242190
ETS1	Unknown	10554042
TP53	Activation	16432214
TP53	Unknown	1724219e

Show/Hide all(66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002548	Process	Monocyte chemotaxis	IDA	8605350, 18079407
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	8248162
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IBA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IDA	1312256, 8605350, 9299537, 15952180
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IEA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IMP	11312102
GO:0005021	Function	Vascular endothelial growth factor receptor activity	TAS	10748050
GO:0005515	Function	Protein binding	IPI	1312256, 7657594, 9393862, 10543948, 12771128, 14684734, 16893970, 18273061, 20660291, 21596751, 23397142, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	8248162
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11513746
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8248162
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006935	Process	Chemotaxis	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	2158038
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10748050
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IMP	8605350
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	9299537, 11513746
GO:0019838	Function	Growth factor binding	IBA
GO:0019838	Function	Growth factor binding	IPI	1312256, 10471394, 11513746, 12366396, 16109918
GO:0030154	Process	Cell differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	8605350
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	8605350
GO:0036323	Process	Vascular endothelial growth factor receptor-1 signaling pathway	IDA	15952180
GO:0036332	Function	Placental growth factor receptor activity	IDA	12796773
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	9299537
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9299537
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	14633857, 28637396
GO:0046777	Process	Protein autophosphorylation	IDA	9299537, 11513746
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	1312256, 9299537
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	11312102
GO:0048514	Process	Blood vessel morphogenesis	ISS
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	14633857
GO:1905563	Process	Negative regulation of vascular endothelial cell proliferation	IGI	22955733
GO:1990384	Process	Hyaloid vascular plexus regression	ISS

MIM	HGNC	e!Ensembl
165070	3763	ENSG00000102755

Protein

UniProt ID

P17948

Protein name

Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)

Protein function

Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, c

PDB

1FLT , 1QSV , 1QSZ , 1QTY , 1RV6 , 2XAC , 3HNG , 4CKV , 4CL7 , 5ABD , 5EX3 , 5T89

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00047	ig	235 → 326	Immunoglobulin domain	Domain
PF07679	I-set	337 → 426	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	560 → 640		Domain
PF07679	I-set	661 → 748	Immunoglobulin I-set domain	Domain
PF17988	VEGFR-2_TMD	753 → 787	VEGFR-2 Transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	827 → 1154	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform 2 is strongly expressed

Sequence

MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
CSPPPDYNSVVLYSTPPI

Sequence length

1338

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway HIF-1 signaling pathway PI3K-Akt signaling pathway Focal adhesion Transcriptional misregulation in cancer Rheumatoid arthritis		Neurophilin interactions with VEGF and VEGFR VEGF binds to VEGFR leading to receptor dimerization

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast cancer	Breast cancer (menopausal hormone therapy interaction)	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Moyamoya Disease	Moyamoya disease	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (208)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3C syndrome	Associate	23704979
AA amyloidosis	Stimulate	39752902
Actinic cheilitis	Associate	25895461
Adenocarcinoma	Associate	21751195, 26525902, 29985074, 35800186
Adenocarcinoma of Lung	Associate	20052735
Alzheimer Disease	Associate	26082458, 30576228, 32989152, 36905877, 39334869, 39752902
Alzheimer Disease	Stimulate	31332262
Amyloidosis	Associate	39752902
Anemia Sickle Cell	Stimulate	37012663
Angina Stable	Associate	36435742
Antiphospholipid Syndrome	Stimulate	16968331
Aortic Valve Insufficiency	Associate	14760594
Arnold Chiari Malformation	Associate	23437350
Arthritis Psoriatic	Associate	31864394
Arthritis Rheumatoid	Associate	17393418, 20108506, 28323906, 30767867
Astrocytoma	Associate	26627848
Balkan Nephropathy	Associate	22977664
Behcet Syndrome	Stimulate	34918882
Bone Diseases	Associate	29149180
Brain Ischemia	Stimulate	11029398, 11279416
Brain Neoplasms	Associate	27926948
Breast Neoplasms	Associate	10360672, 18630531, 18715621, 21119072, 23832257, 25202046, 25604142, 25971960, 27357606, 29728589, 30063723, 34793664
Breast Neoplasms	Stimulate	23113927
Calcinosis Cutis	Inhibit	21945343
Calcinosis Cutis	Stimulate	23577117
Calcinosis Cutis	Associate	34793664
Carcinogenesis	Associate	11141500, 20027224, 20205278, 25895461
Carcinoid Tumor	Associate	23339006
Carcinoma Acinar Cell	Associate	23771070
Carcinoma Ductal Breast	Associate	21606203
Carcinoma Hepatocellular	Associate	21345006, 23397142, 23737988, 26551737, 28358369, 33673041
Carcinoma Non Small Cell Lung	Associate	26134224, 29991059
Carcinoma Renal Cell	Associate	11846206, 18041056, 28754676, 29202733, 30852945, 34870494, 37657024
Carcinoma Squamous Cell	Associate	22355056
Carcinoma Squamous Cell	Stimulate	25895461
Carcinoma Transitional Cell	Associate	9823778
Cardiomyopathies	Associate	11029398, 33988313, 36435742
Cardiomyopathy Dilated	Associate	33988313
Cardiovascular Diseases	Associate	27736948, 30423812, 33988313, 39762845
Cerebral Infarction	Associate	33712886
Cholangiocarcinoma	Associate	20565817, 23704979, 35558087
Chronic Disease	Stimulate	32260158
Cognition Disorders	Associate	31332262, 39752902
Colorectal Neoplasms	Associate	16685275, 17214745, 17970067, 20205278, 20222950, 23580180, 23799978, 23831629, 24908415, 25880726, 26072521, 26537064, 27049304, 28468595, 30423986, 31717527, 34470574, 36264073 View all (3 more)
Composite Lymphoma	Associate	34791601
Coronary Artery Disease	Associate	27736948
Coronary Disease	Associate	16139132
Death	Associate	28338114
Dementia	Associate	36421848
Diabetes Gestational	Associate	20674013, 28817576
Diabetes Mellitus	Inhibit	16139132
Diabetes Mellitus Type 1	Stimulate	34149611
Diabetic Nephropathies	Associate	11499563, 15610240
Diabetic Retinopathy	Associate	32836220
Disease	Associate	28323906
Drug Related Side Effects and Adverse Reactions	Inhibit	23364970
Drug Resistant Epilepsy	Stimulate	23341958
Endometrial Neoplasms	Stimulate	23051953
Endometrial Neoplasms	Associate	31322068
Endometriosis	Associate	26773192
Enterocolitis Necrotizing	Associate	31383782
Fetal Growth Retardation	Associate	21810232, 25491486, 35090410, 39218008
Fetal Growth Retardation	Stimulate	32215825
Focal Nodular Hyperplasia	Associate	30678450
Gastrointestinal Neoplasms	Associate	19755510
Gastrointestinal Stromal Tumors	Associate	17036392
Gingivitis	Associate	29149180
Glioblastoma	Associate	21691733, 28797294, 31991805, 36043525, 36941554
Glioma	Associate	10682677, 27385209, 27613831, 8774132
Glomerulonephritis IGA	Associate	32790760
Growth Disorders	Associate	10780661
Headache	Associate	32929141
Heart Diseases	Associate	33988313
Heart Failure	Inhibit	28652462
Heart Failure	Associate	28652462, 36435742
Heart Septal Defects Ventricular	Associate	30423812
HELLP Syndrome	Associate	20541258
HELLP Syndrome	Stimulate	25583406
Hemangioendothelioma Epithelioid	Associate	20104492
Hemangioma	Associate	11733376, 18931684
Hemangioma Capillary	Associate	8644848
Hemangioma capillary infantile	Associate	18287964, 18931684, 29664206
Hemangiosarcoma	Associate	20949568
Hemolysis	Inhibit	11943725
Hemolytic Uremic Syndrome	Associate	22563920
Hyperalgesia	Associate	35354377
Hyperglycemia	Associate	29351188
Hypertension	Associate	17105340, 29466360, 37178326, 37561089
Hypoxia	Associate	18270456, 23788753, 29351188, 33599733
Hypoxia	Stimulate	21641407, 25583406, 34665260
Hypoxia Brain	Associate	14602804
Hypoxia Brain	Stimulate	18270456, 24098721, 9036922
Idiopathic Pulmonary Fibrosis	Associate	20169144
Infarction	Associate	33712886
Inflammation	Associate	20108506, 20222950, 25895461, 27424135, 28323906
Inflammatory Breast Neoplasms	Associate	22813402
Ischemia	Associate	33712886
Joint Diseases	Associate	21163925
Kidney Diseases	Associate	11499563
Kidney Diseases	Stimulate	36555698
Kidney Failure Chronic	Associate	19197998
Laryngeal Neoplasms	Associate	27075652
Leiomyoma	Associate	17036392
Leiomyosarcoma	Associate	25340839
Leukemia	Associate	15651075, 16249383, 22566481, 26308964, 31834935
Leukemia Lymphocytic Chronic B Cell	Associate	14996703
Leukemia Myeloid Acute	Associate	12036858, 16249383, 17420287, 19463770, 23509773, 9058706
Leukemia Myelomonocytic Chronic	Associate	11222390
Liver Cirrhosis	Associate	33673041
Lung Diseases	Associate	22795057
Lung Neoplasms	Associate	22593690, 30674935
Lupus Erythematosus Systemic	Associate	32929141
Lymphatic Metastasis	Stimulate	17486129, 19385972, 23113927
Lymphatic Metastasis	Associate	23737988
Lymphoma	Associate	15311211, 17998899, 19821819
Lymphoma Large B Cell Diffuse	Associate	17694324, 17998899, 19821819
Macrophage Activation Syndrome	Associate	23737988
Macular Degeneration	Associate	28949775, 33599733, 33604378, 37862026
Macular Degeneration	Stimulate	35370941
Malaria	Stimulate	17105340
Medulloblastoma	Associate	17704359, 29377550
Melanoma	Associate	10886518, 11121133, 20004943, 24868139, 31758648, 7744769
Menorrhagia	Associate	16169405, 17336974
Mesothelioma Malignant	Associate	19505392
Microvascular Angina	Stimulate	34966385
Multiple Myeloma	Associate	14644994
Multiple Sclerosis	Associate	27424135
Myelodysplastic Syndromes	Associate	12100142
Myoma	Associate	27306124
Myxoma	Associate	15118294
Necrosis	Stimulate	36822023
Neoplasm Invasiveness	Stimulate	24908415
Neoplasm Metastasis	Associate	16432214, 21345006, 23113927, 23577117, 23580180, 24977165, 26394830, 26525902, 28072723, 30985194
Neoplasm Metastasis	Stimulate	17486129, 20544684, 24908415, 31200683, 33294440
Neoplasm Recurrence Local	Stimulate	24908415
Neoplasms	Associate	10487612, 11141500, 11846206, 12368197, 12439912, 12560388, 12824880, 15118294, 16432214, 16532435, 16685275, 17036392, 17694324, 18041056, 18626467 View all (53 more)
Neoplasms	Stimulate	10748050, 14521839, 15107801, 19816005, 36264073
Neoplasms	Inhibit	17970067, 25888191
Nephrosis Lipoid	Associate	22977664
Neuralgia	Associate	35354377
Neurilemmoma	Associate	17036392
Neuroblastoma	Associate	11815985, 20179233
Neurodegenerative Diseases	Associate	39752902
Neurofibroma Plexiform	Associate	21703400
Non functioning pancreatic endocrine tumor	Associate	23211371
Obesity	Associate	15298982, 29244802
Obesity Maternal	Associate	28939845
Oculocerebrorenal Syndrome	Associate	11943725
Osteoarthritis	Associate	19303468, 31257478, 32384383
Osteosarcoma	Associate	29474747
Ovarian Hyperstimulation Syndrome	Associate	24851136, 28820403
Ovarian Neoplasms	Associate	24909162, 26260910, 31200683, 33235818, 33713666
Pain	Stimulate	32384383
Pancreatic Neoplasms	Associate	15952180, 16532435, 20367641, 28338114
Papillomavirus Infections	Associate	26666815
Parotid Neoplasms	Associate	29521047
Peritonitis	Associate	22563920
Peritonitis	Inhibit	23585849
Pheochromocytoma	Stimulate	12368197
Pheochromocytoma	Associate	24675699
Pleural Effusion	Associate	23190621
Pneumonia Aspiration	Associate	12668796
Polycystic Ovary Syndrome	Associate	31115532
Pre Eclampsia	Inhibit	11943725, 20021269
Pre Eclampsia	Stimulate	14602804, 24465515, 28939845, 34195300
Pre Eclampsia	Associate	17105340, 17616861, 18443340, 19498340, 20541258, 21183218, 21641407, 21810232, 22215706, 23437230, 23899470, 24636199, 27207105, 28652462, 29683202 View all (11 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16249383
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12100142, 26674118, 36321792
Preeclamptic toxemia	Inhibit	14602804
Preeclamptic toxemia	Associate	24636199, 27199113, 29172779
Premature Birth	Stimulate	25583406
Prostatic Hyperplasia	Associate	11330643
Prostatic Neoplasms	Associate	12824880, 19385972, 21652578, 25894226
Prostatitis	Associate	12824880
Proteinuria	Associate	19168169
Pulmonary Disease Chronic Obstructive	Associate	15681497
Pyuria	Associate	32929141
Renal Insufficiency Chronic	Associate	33988313, 36555698
Respiratory Distress Syndrome	Stimulate	19327291
Respiratory Distress Syndrome	Associate	31982041
Respiratory Tract Infections	Associate	22977664
Retinal Vein Occlusion	Associate	35370941
Retinoblastoma	Associate	20860824
Sarcoidosis Pulmonary	Inhibit	20169144
Sarcoma Myeloid	Associate	16249383
Schizophrenia	Associate	28117656
Sepsis	Associate	31982041
Severe Acute Respiratory Syndrome	Stimulate	37949031
Small Cell Lung Carcinoma	Associate	31199602
Solitary Fibrous Tumors	Associate	40660115
Spastic paraplegia 11 autosomal recessive	Associate	9823778
Squamous Cell Carcinoma of Head and Neck	Associate	22203933, 26666815, 28718364, 29149180
Status Asthmaticus	Inhibit	26869672
Stomach Neoplasms	Associate	12439912, 17486129, 17659711, 19068081, 23364970, 24398900
Stroke	Stimulate	33712886
Tertiary Lymphoid Structures	Stimulate	20052735
Tertiary Lymphoid Structures	Associate	22203933
Thymic epithelial tumor	Associate	24908332
Thyroid Cancer Papillary	Associate	30678450
Triple Negative Breast Neoplasms	Associate	36822023
Urinary Bladder Neoplasms	Associate	9823778
Uterine Cervical Neoplasms	Associate	25674215, 28072723, 31289124
Uveal melanoma	Associate	24868139
Varicose Veins	Associate	14760594
Vascular Diseases	Associate	24316428, 29466360, 32260307, 32713274, 36555698
Vascular System Injuries	Associate	39752902
Wilms Tumor	Associate	12560388
Wounds and Injuries	Associate	29466360, 32790760

FLT1 (fms related receptor tyrosine kinase 1)