Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23209
Gene name Gene Name - the full gene name approved by the HGNC.
Modulator of VRAC current 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MLC1
Synonyms (NCBI Gene) Gene synonyms aliases
LVM, MLC, VL
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The function of this gene product is unknown; however, homology to other proteins suggests that it may be an integral membrane transporter. Mutations in this gene have been associated with megalencephalic leukoencephalopathy with subcortical cysts, an aut
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs80358241 ->G Pathogenic Frameshift variant, coding sequence variant, intron variant, non coding transcript variant
rs80358242 C>T Likely-pathogenic, pathogenic Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs80358243 A>G,T Likely-pathogenic Intron variant
rs80358245 G>A Likely-pathogenic Coding sequence variant, intron variant, non coding transcript variant, missense variant
rs121908343 G>A,T Pathogenic Intron variant, synonymous variant, non coding transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017034 hsa-miR-335-5p Microarray 18185580
MIRT1150585 hsa-miR-1184 CLIP-seq
MIRT1150586 hsa-miR-150 CLIP-seq
MIRT1150587 hsa-miR-3157-3p CLIP-seq
MIRT1150588 hsa-miR-342-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17628813, 19931615, 22328087, 32814053
GO:0005737 Component Cytoplasm IDA 15892299
GO:0005737 Component Cytoplasm IEA
GO:0005764 Component Lysosome IEA
GO:0005764 Component Lysosome ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605908 17082 ENSG00000100427
Protein
UniProt ID Q15049
Protein name Membrane protein MLC1 (Megalencephalic leukoencephalopathy with subcortical cysts protein 1)
Protein function Transmembrane protein mainly expressed in brain astrocytes that may play a role in transport across the blood-brain and brain-cerebrospinal fluid barriers (PubMed:22328087). Regulates the response of astrocytes to hypo-osmosis by promoting calci
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in the brain, with highest levels found in the amygdala, nucleus caudatus, thalamus and hippocampus. {ECO:0000269|PubMed:11326298}.
Sequence
MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHKTWVFSVLMGS
CLLVTSGFSLYLGNVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQILFVSTFA
VTTTCLIWFGCKLVLNPSAININFNLILLLLLELLMAATVIIAARSSEEDCKKKKGSMSD
SANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHLSVTFFWILVACF
PSAIASHVAAECPSKCLVEVLIAISSLTSPLLFTASGYLSFSIMRIVEMFKDYPPAIKPS
YDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLK
EFDKEKAWRAVVVQMAQ
Sequence length 377
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Megalencephalic Leukoencephalopathy With Subcortical Cysts megalencephalic leukoencephalopathy with subcortical cysts, Megalencephalic leukoencephalopathy with subcortical cysts 1 rs1602049346, rs281875317, rs755271052, rs267607236, rs781004589, rs1057517375, rs80358242, rs281875316, rs281875315, rs769135961, rs1555967668, rs752428321, rs281875313, rs80358245, rs1057517090
View all (27 more)
N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 21315556
Adenocarcinoma Associate 32509861
Alzheimer Disease Associate 24439168
Amyloidosis Associate 12515719, 21315556, 31364359
Arthritis Juvenile Associate 12562401, 2022732
Arthritis Rheumatoid Associate 12562401, 8218839
Astrocytoma Associate 32521795, 36078064
Brain Edema Associate 36078064
Brain Neoplasms Associate 37722850
Breast Neoplasms Associate 11259089, 27773611