Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23208
Gene name Gene Name - the full gene name approved by the HGNC.
Synaptotagmin 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SYT11
Synonyms (NCBI Gene) Gene synonyms aliases
SYT12, sytXI
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. The encoded protein is a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051123 hsa-miR-16-5p CLASH 23622248
MIRT047413 hsa-miR-10b-5p CLASH 23622248
MIRT665984 hsa-miR-1273d HITS-CLIP 23824327
MIRT665983 hsa-miR-3675-3p HITS-CLIP 23824327
MIRT665982 hsa-miR-6849-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000149 Function SNARE binding IBA
GO:0000149 Function SNARE binding IEA
GO:0001778 Process Plasma membrane repair IEA
GO:0001778 Process Plasma membrane repair ISS
GO:0001818 Process Negative regulation of cytokine production IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608741 19239 ENSG00000132718
Protein
UniProt ID Q9BT88
Protein name Synaptotagmin-11 (Synaptotagmin XI) (SytXI)
Protein function Synaptotagmin family member involved in vesicular and membrane trafficking which does not bind Ca(2+). Inhibits clathrin-mediated and bulk endocytosis, functions to ensure precision in vesicle retrieval. Plays an important role in dopamine trans
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 172 279 C2 domain Domain
PF00168 C2 306 414 C2 domain Domain
Sequence
MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLK
GISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCID
QLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQE
AHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDL
VLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTR
DIIKRNIQKCISRGELQVSLS
YQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFN
ESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREV
CESPRK
PVAKWHSLSEY
Sequence length 431
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34857756, 40631452
Cognition Disorders Associate 34857756
Diabetes Mellitus Type 2 Inhibit 35753051
Lung Neoplasms Associate 36170810
Lysosomal Storage Diseases Inhibit 27278822
Multiple Sclerosis Associate 30582321
Neoplasm Metastasis Associate 36170810
Neoplasms Associate 36170810
Neurodegenerative Diseases Associate 27278822
Parkinson Disease Associate 21812969, 22786590, 24312176, 27278822, 27393345, 33349842