Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23178
Gene name Gene Name - the full gene name approved by the HGNC.	PAS domain containing serine/threonine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PASK
Synonyms (NCBI Gene) Gene synonyms aliases	PASKIN, STK37
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the serine/threonine kinase family that contains two PAS domains. Expression of this gene is regulated by glucose, and the encoded protein plays a role in the regulation of insulin gene expression. Downregulation of this gene

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024926	hsa-miR-215-5p	Microarray	19074876
MIRT026483	hsa-miR-192-5p	Microarray	19074876
MIRT1214978	hsa-miR-18a	CLIP-seq
MIRT1214979	hsa-miR-18b	CLIP-seq
MIRT1214980	hsa-miR-4422	CLIP-seq
MIRT1214981	hsa-miR-4735-3p	CLIP-seq
MIRT1214982	hsa-miR-4775	CLIP-seq
MIRT1214978	hsa-miR-18a	CLIP-seq
MIRT1214979	hsa-miR-18b	CLIP-seq
MIRT1214980	hsa-miR-4422	CLIP-seq
MIRT1214981	hsa-miR-4735-3p	CLIP-seq
MIRT1214982	hsa-miR-4775	CLIP-seq
MIRT1214978	hsa-miR-18a	CLIP-seq
MIRT1214979	hsa-miR-18b	CLIP-seq
MIRT1214980	hsa-miR-4422	CLIP-seq
MIRT1214981	hsa-miR-4735-3p	CLIP-seq
MIRT1214982	hsa-miR-4775	CLIP-seq
MIRT1214978	hsa-miR-18a	CLIP-seq
MIRT1214979	hsa-miR-18b	CLIP-seq
MIRT1214980	hsa-miR-4422	CLIP-seq
MIRT1214981	hsa-miR-4735-3p	CLIP-seq
MIRT1214982	hsa-miR-4775	CLIP-seq
MIRT1214978	hsa-miR-18a	CLIP-seq
MIRT1214979	hsa-miR-18b	CLIP-seq
MIRT1214980	hsa-miR-4422	CLIP-seq
MIRT1214981	hsa-miR-4735-3p	CLIP-seq
MIRT1214982	hsa-miR-4775	CLIP-seq
MIRT2290257	hsa-miR-1	CLIP-seq
MIRT2290258	hsa-miR-141	CLIP-seq
MIRT1214978	hsa-miR-18a	CLIP-seq
MIRT1214979	hsa-miR-18b	CLIP-seq
MIRT2290259	hsa-miR-200a	CLIP-seq
MIRT2290260	hsa-miR-206	CLIP-seq
MIRT2290261	hsa-miR-3673	CLIP-seq
MIRT2290262	hsa-miR-4307	CLIP-seq
MIRT1214980	hsa-miR-4422	CLIP-seq
MIRT1214981	hsa-miR-4735-3p	CLIP-seq
MIRT1214982	hsa-miR-4775	CLIP-seq
MIRT2290263	hsa-miR-613	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16275910, 17595531, 20943661, 21418524
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16275910, 17595531, 21418524
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17595531
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17595531
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006468	Process	Protein phosphorylation	IDA	16275910
GO:0008289	Function	Lipid binding	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035091	Function	Phosphatidylinositol binding	IDA	21418524
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0043576	Process	Regulation of respiratory gaseous exchange	IEA
GO:0043576	Process	Regulation of respiratory gaseous exchange	ISS
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	IBA
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	IDA	16275910
GO:0045727	Process	Positive regulation of translation	TAS	17595531
GO:0046777	Process	Protein autophosphorylation	IDA	20943661, 21418524
GO:0070092	Process	Regulation of glucagon secretion	IEA
GO:0070092	Process	Regulation of glucagon secretion	ISS
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
607505	17270	ENSG00000115687

Protein

UniProt ID

Q96RG2

Protein name

PAS domain-containing serine/threonine-protein kinase (PAS-kinase) (PASKIN) (hPASK) (EC 2.7.11.1)

Protein function

Serine/threonine-protein kinase involved in energy homeostasis and protein translation. Phosphorylates EEF1A1, GYS1, PDX1 and RPS6. Probably plays a role under changing environmental conditions (oxygen, glucose, nutrition), rather than under sta

PDB

1LL8 , 3DLS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13426	PAS_9	131 → 233	PAS domain	Domain
PF13426	PAS_9	345 → 414	PAS domain	Domain
PF00069	Pkinase	999 → 1251	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with slightly higher expression in brain, prostate and testis. Reduced expression was found in placenta. Present in germ cells of testis and in the midpiece of sperm tails (at protein level).

Sequence

MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVST
WVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSV
GRARDGTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGNESGCGER
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDEIRKLMESQDIFTGTQTELIAGGQLLSC
LSPQPAPGVDNVPEGSLPVHGEQALPKDQQITALGREEPVAIESPGQDLLGESRSEPVDV
KPFASCEDSEAPVPAEDGGSDAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAKPQAKGQ
LAGGSLLMHCPCYGSEWGLWWRSQDLAPSPSGMAGLSFGTPTLDEPWLGVENDREELQTC
LIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLGGRDLCGGCTGSSSACYALAT
DLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETPSSLAVGSDPD
VGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD
RESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYH
RDGLRLSIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAE
LTGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKE
KNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLV
MEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF
TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEE
NPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADY
TWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRL
LTS

Sequence length

1323

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Kidney Disease	Chronic kidney disease	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Insulin Resistance	Associate	19440050

PASK (PAS domain containing serine/threonine kinase)