Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23142
Gene name Gene Name - the full gene name approved by the HGNC.
Defective in cullin neddylation 1 domain containing 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCUN1D4
Synonyms (NCBI Gene) Gene synonyms aliases
DCNL4
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q12
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019951 hsa-miR-375 Microarray 20215506
MIRT050924 hsa-miR-17-5p CLASH 23622248
MIRT164842 hsa-miR-27a-3p HITS-CLIP 22473208
MIRT164846 hsa-miR-27b-3p HITS-CLIP 22473208
MIRT927926 hsa-miR-1179 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA
GO:0005515 Function Protein binding IPI 21911577, 23201271, 26906416
GO:0005634 Component Nucleus IDA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus IMP 26906416
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612977 28998 ENSG00000109184
Protein
UniProt ID Q92564
Protein name DCN1-like protein 4 (DCNL4) (DCUN1 domain-containing protein 4) (Defective in cullin neddylation protein 1-like protein 4)
Protein function Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which are necessary for the activation of cullin-RING E3 ubiquitin
PDB 5V89
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03556 Cullin_binding 175 285 Cullin binding Family
Sequence
MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKV
MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVV
GPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTL
DYLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLE
QSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEW
YKDKQMS
Sequence length 292
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Lung adenocarcinoma Familial squamous cell lung carcinoma N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS