Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	231
Gene name Gene Name - the full gene name approved by the HGNC.	Aldo-keto reductase family 1 member B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AKR1B1
Synonyms (NCBI Gene) Gene synonyms aliases	ADR, ALDR1, ALR2, AR
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated i

Show/Hide all(146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025547	hsa-miR-34a-5p	Proteomics	21566225
MIRT038212	hsa-miR-342-5p	CLASH	23622248
MIRT036537	hsa-miR-1226-3p	CLASH	23622248
MIRT776271	hsa-miR-214	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT776273	hsa-miR-3154	CLIP-seq
MIRT776274	hsa-miR-330-3p	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT776271	hsa-miR-214	CLIP-seq
MIRT1929130	hsa-miR-2355-5p	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT1929131	hsa-miR-3679-3p	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT776271	hsa-miR-214	CLIP-seq
MIRT1929130	hsa-miR-2355-5p	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT1929131	hsa-miR-3679-3p	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2426162	hsa-miR-3148	CLIP-seq
MIRT2426163	hsa-miR-3662	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2435292	hsa-miR-3660	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2435293	hsa-miR-4526	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2435294	hsa-miR-526b	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2472638	hsa-miR-1264	CLIP-seq
MIRT2472639	hsa-miR-1304	CLIP-seq
MIRT2472640	hsa-miR-139-5p	CLIP-seq
MIRT2472641	hsa-miR-140-3p	CLIP-seq
MIRT2472642	hsa-miR-1827	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2472643	hsa-miR-2110	CLIP-seq
MIRT2472644	hsa-miR-31	CLIP-seq
MIRT2472645	hsa-miR-3144-5p	CLIP-seq
MIRT2426162	hsa-miR-3148	CLIP-seq
MIRT2472646	hsa-miR-3150a-3p	CLIP-seq
MIRT2472647	hsa-miR-3156-3p	CLIP-seq
MIRT2472648	hsa-miR-3191	CLIP-seq
MIRT2472649	hsa-miR-3614-5p	CLIP-seq
MIRT2435292	hsa-miR-3660	CLIP-seq
MIRT2426163	hsa-miR-3662	CLIP-seq
MIRT2472650	hsa-miR-4301	CLIP-seq
MIRT2472651	hsa-miR-4305	CLIP-seq
MIRT2472652	hsa-miR-431	CLIP-seq
MIRT2472653	hsa-miR-4311	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2435293	hsa-miR-4526	CLIP-seq
MIRT2472654	hsa-miR-4652-5p	CLIP-seq
MIRT2472655	hsa-miR-4663	CLIP-seq
MIRT2472656	hsa-miR-4690-5p	CLIP-seq
MIRT2472657	hsa-miR-4701-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2472658	hsa-miR-4719	CLIP-seq
MIRT2472659	hsa-miR-4742-5p	CLIP-seq
MIRT2472660	hsa-miR-4765	CLIP-seq
MIRT2435294	hsa-miR-526b	CLIP-seq
MIRT2472661	hsa-miR-552	CLIP-seq
MIRT2472662	hsa-miR-588	CLIP-seq
MIRT2472663	hsa-miR-626	CLIP-seq
MIRT2472664	hsa-miR-628-5p	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2472665	hsa-miR-720	CLIP-seq
MIRT2472638	hsa-miR-1264	CLIP-seq
MIRT2472639	hsa-miR-1304	CLIP-seq
MIRT2674852	hsa-miR-133a	CLIP-seq
MIRT2674853	hsa-miR-133b	CLIP-seq
MIRT2472640	hsa-miR-139-5p	CLIP-seq
MIRT2472641	hsa-miR-140-3p	CLIP-seq
MIRT2674854	hsa-miR-145	CLIP-seq
MIRT2472642	hsa-miR-1827	CLIP-seq
MIRT2674855	hsa-miR-192	CLIP-seq
MIRT2426161	hsa-miR-1972	CLIP-seq
MIRT2472643	hsa-miR-2110	CLIP-seq
MIRT776271	hsa-miR-214	CLIP-seq
MIRT2674856	hsa-miR-215	CLIP-seq
MIRT1929130	hsa-miR-2355-5p	CLIP-seq
MIRT2472644	hsa-miR-31	CLIP-seq
MIRT776272	hsa-miR-3132	CLIP-seq
MIRT2472645	hsa-miR-3144-5p	CLIP-seq
MIRT2426162	hsa-miR-3148	CLIP-seq
MIRT2472646	hsa-miR-3150a-3p	CLIP-seq
MIRT776273	hsa-miR-3154	CLIP-seq
MIRT2472647	hsa-miR-3156-3p	CLIP-seq
MIRT2472648	hsa-miR-3191	CLIP-seq
MIRT776274	hsa-miR-330-3p	CLIP-seq
MIRT2674857	hsa-miR-3529	CLIP-seq
MIRT2674858	hsa-miR-3613-5p	CLIP-seq
MIRT2472649	hsa-miR-3614-5p	CLIP-seq
MIRT776275	hsa-miR-3619-5p	CLIP-seq
MIRT2435292	hsa-miR-3660	CLIP-seq
MIRT2674859	hsa-miR-3661	CLIP-seq
MIRT2426163	hsa-miR-3662	CLIP-seq
MIRT1929131	hsa-miR-3679-3p	CLIP-seq
MIRT2674860	hsa-miR-379	CLIP-seq
MIRT2674861	hsa-miR-3977	CLIP-seq
MIRT2674862	hsa-miR-4274	CLIP-seq
MIRT2472650	hsa-miR-4301	CLIP-seq
MIRT2472651	hsa-miR-4305	CLIP-seq
MIRT2472652	hsa-miR-431	CLIP-seq
MIRT2472653	hsa-miR-4311	CLIP-seq
MIRT2674863	hsa-miR-4451	CLIP-seq
MIRT2426164	hsa-miR-450b-5p	CLIP-seq
MIRT2435293	hsa-miR-4526	CLIP-seq
MIRT776276	hsa-miR-4530	CLIP-seq
MIRT776277	hsa-miR-4650-3p	CLIP-seq
MIRT2472654	hsa-miR-4652-5p	CLIP-seq
MIRT2472655	hsa-miR-4663	CLIP-seq
MIRT2472656	hsa-miR-4690-5p	CLIP-seq
MIRT2472657	hsa-miR-4701-5p	CLIP-seq
MIRT2426165	hsa-miR-4708-3p	CLIP-seq
MIRT2472658	hsa-miR-4719	CLIP-seq
MIRT2472659	hsa-miR-4742-5p	CLIP-seq
MIRT2674864	hsa-miR-4753-3p	CLIP-seq
MIRT2472660	hsa-miR-4765	CLIP-seq
MIRT2674865	hsa-miR-4766-5p	CLIP-seq
MIRT2674866	hsa-miR-488	CLIP-seq
MIRT2435294	hsa-miR-526b	CLIP-seq
MIRT2472661	hsa-miR-552	CLIP-seq
MIRT2472662	hsa-miR-588	CLIP-seq
MIRT2472663	hsa-miR-626	CLIP-seq
MIRT2472664	hsa-miR-628-5p	CLIP-seq
MIRT2674867	hsa-miR-631	CLIP-seq
MIRT2426166	hsa-miR-642b	CLIP-seq
MIRT2472665	hsa-miR-720	CLIP-seq
MIRT776278	hsa-miR-761	CLIP-seq
MIRT2674868	hsa-miR-9	CLIP-seq
MIRT2674869	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
EGR1	Unknown	12890669

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IMP	12732097
GO:0001758	Function	Retinal dehydrogenase (NAD+) activity	IDA	12732097
GO:0002070	Process	Epithelial cell maturation	IEA
GO:0003091	Process	Renal water homeostasis	IEA
GO:0004032	Function	Aldose reductase (NADPH) activity	EXP	1420136, 2112546, 8645003
GO:0004032	Function	Aldose reductase (NADPH) activity	IBA
GO:0004032	Function	Aldose reductase (NADPH) activity	IDA	8435445
GO:0004032	Function	Aldose reductase (NADPH) activity	IEA
GO:0004032	Function	Aldose reductase (NADPH) activity	TAS	2112546
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	TAS	2112546
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005975	Process	Carbohydrate metabolic process	TAS	2112546
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006700	Process	C21-steroid hormone biosynthetic process	TAS
GO:0009055	Function	Electron transfer activity	TAS	2112546
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0035809	Process	Regulation of urine volume	IEA
GO:0036130	Function	Prostaglandin H2 endoperoxidase reductase activity	IEA
GO:0042572	Process	Retinol metabolic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043795	Function	Glyceraldehyde oxidoreductase activity	IDA	20837989
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0046370	Process	Fructose biosynthetic process	IEA
GO:0046370	Process	Fructose biosynthetic process	TAS
GO:0047655	Function	Allyl-alcohol dehydrogenase activity	IEA
GO:0047939	Function	L-glucuronate reductase activity	IEA
GO:0047956	Function	Glycerol dehydrogenase (NADP+) activity	IEA
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071475	Process	Cellular hyperosmotic salinity response	IDA	8435445
GO:0072205	Process	Metanephric collecting duct development	IEA

MIM	HGNC	e!Ensembl
103880	381	ENSG00000085662

Protein

UniProt ID

P15121

Protein name

Aldo-keto reductase family 1 member B1 (EC 1.1.1.21) (EC 1.1.1.300) (EC 1.1.1.372) (EC 1.1.1.54) (Aldehyde reductase) (Aldose reductase) (AR)

Protein function

Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosachari

PDB

1ABN , 1ADS , 1AZ1 , 1AZ2 , 1EF3 , 1EL3 , 1IEI , 1MAR , 1PWL , 1PWM , 1T40 , 1T41 , 1US0 , 1X96 , 1X97 , 1X98 , 1XGD , 1Z3N , 1Z89 , 1Z8A , 2ACQ , 2ACR , 2ACS , 2ACU , 2AGT , 2DUX , 2DUZ , 2DV0 , 2F2K , 2FZ8 , 2FZ9 , 2FZB , 2FZD , 2HV5 , 2HVN , 2HVO , 2I16 , 2I17 , 2IKG , 2IKH , 2IKI , 2IKJ , 2INE , 2INZ , 2IPW , 2IQ0 , 2IQD , 2IS7 , 2ISF , 2J8T , 2NVC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00248	Aldo_ket_red	15 → 294	Aldo/keto reductase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress. {ECO:0000269|PubMed:8435445}.

Sequence

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF

Sequence length

316

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Fructose and mannose metabolism Galactose metabolism Glycerolipid metabolism Folate biosynthesis Metabolic pathways		Pregnenolone biosynthesis Fructose biosynthesis

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Hypertension (confirmatory factor analysis Factor 12), Hypertension	N/A	N/A	GWAS

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Albuminuria	Associate	28805547
Asthma	Associate	29726087
Atherosclerosis	Associate	18451330, 26873505
Breast Neoplasms	Associate	35807227, 36454866
Carcinogenesis	Associate	35962452
Carcinoma Hepatocellular	Associate	18325492, 24607627, 9565553
Carcinoma Non Small Cell Lung	Associate	35962452
Cardio Renal Syndrome	Associate	18716049
Chronic Disease	Associate	16356117
Colorectal Neoplasms	Associate	17300864, 21576240, 23732517, 24393480, 27493446, 35807227, 36301939
Cystinosis	Associate	18325349
Diabetes Complications	Associate	14515207, 16356117, 2498333
Diabetes Mellitus	Associate	12943962, 14515207, 16356117, 16911628, 18451330, 21084309, 26873505, 35029856, 9760169
Diabetes Mellitus Type 1	Associate	11231353, 17563730, 9489533
Diabetes Mellitus Type 2	Associate	14515207, 16911628, 18716049, 20353610, 35029856, 37218221
Diabetic Angiopathies	Associate	16911628
Diabetic Foot	Associate	26579581, 29115286
Diabetic Nephropathies	Associate	11231353, 11422753, 18325349, 35029856
Diabetic Neuropathies	Associate	33820886, 9489533
Diabetic Retinopathy	Associate	17563730, 20424224, 21067572, 29115286, 31539366, 37218221
DNA Virus Infections	Associate	18096195
Drug Related Side Effects and Adverse Reactions	Associate	23732517, 23770200, 37336288
general anxiety disorder	Associate	28198454
Glioblastoma	Associate	37336288
Glioma	Associate	32778640, 35341178
Glomerulonephritis Membranous	Associate	20150532
Glycosuria Renal	Associate	18716049
Hyperglycemia	Stimulate	11422753
Hyperglycemia	Associate	19383984, 25283348, 26873505, 35029856, 40724989
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	19383984, 40724989
Hyperlipidemias	Associate	18451330
Hypertensive Retinopathy	Associate	37218221
Hyperuricemia	Associate	24556878
Hypoxia	Associate	21576240
Inflammation	Associate	21576240, 24663124, 27322952, 40724989
Kidney Diseases	Associate	11231353, 11422753
Kidney Failure Chronic	Associate	18716049
Leiomyoma	Associate	21496801, 30567472
Multiple Sclerosis	Associate	36680379
Muscular Dystrophy Duchenne	Stimulate	27322952
Myotonic Dystrophy	Associate	17563730
Neoplasms	Associate	15928807, 18325492, 19028477, 19407367, 20460771, 27028854, 34039789, 35341178, 35807227, 35962452, 36221394, 36301939
Neoplasms	Stimulate	39375438
Nervous System Diseases	Associate	9489533
Neurodegenerative Diseases	Associate	25451566
Parkinson Disease	Inhibit	17270157
Pheochromocytoma	Associate	34039789
Plaque Atherosclerotic	Associate	18451330
Pulmonary Disease Chronic Obstructive	Associate	36475041
Rhinitis	Associate	29726087
Rhinitis Allergic	Associate	29726087
Stomach Neoplasms	Associate	36221394, 36397644, 39375438
Stroke	Associate	16911628
Tongue Neoplasms	Associate	19407367
Vascular System Injuries	Associate	24556878

AKR1B1 (aldo-keto reductase family 1 member B)