Gene Gene information from NCBI Gene database.
Entrez ID 2309
Gene name Forkhead box O3
Gene symbol FOXO3
Synonyms (NCBI Gene)
AF6q21FKHRL1FKHRL1P2FOXO2FOXO3A
Chromosome 6
Chromosome location 6q21
Summary This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene
miRNA miRNA information provided by mirtarbase database.
1363
miRTarBase ID miRNA Experiments Reference
MIRT000671 hsa-miR-182-5p Luciferase reporter assayWestern blot 19188590
MIRT000671 hsa-miR-182-5p Luciferase reporter assayWestern blot 19188590
MIRT000671 hsa-miR-182-5p Review 19935707
MIRT004495 hsa-miR-155-5p qRT-PCRLuciferase reporter assayWestern blot 20371610
MIRT000434 hsa-miR-221-3p qRT-PCRChIPLuciferase reporter assayWestern blotNorthern blot 20388878
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
ABL1 Activation 15509806
NFKB1 Unknown 19299143
RELA Unknown 19299143
SIRT1 Repression 17558024;21841822
SIRT3 Unknown 23665396
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
115
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18393360, 20371612, 21621563
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18787191
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602681 3821 ENSG00000118689
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43524
Protein name Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma-like 1)
Protein function Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy (PubMed:10102273, PubMed:16751106, PubMed:21329882, PubMed:30513302). Acts as a positi
PDB 2K86 , 2LQH , 2LQI , 2UZK , 6MNL , 7V9B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 157 244 Forkhead domain Domain
PF16675 FOXO_KIX_bdg 432 511 KIX-binding domain of forkhead box O, CR2 Family
PF16676 FOXO-TAD 604 645 Transactivation domain of FOXO protein family Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9479491}.
Sequence
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSG
KAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVML
RNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG
Sequence length 673
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
Chemokine signaling pathway
FoxO signaling pathway
Mitophagy - animal
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Neurotrophin signaling pathway
Prolactin signaling pathway
Alcoholic liver disease
Shigellosis
Chemical carcinogenesis - reactive oxygen species
Endometrial cancer
Non-small cell lung cancer
  Signaling by NODAL
AKT phosphorylates targets in the nucleus
Constitutive Signaling by AKT1 E17K in Cancer
MAPK6/MAPK4 signaling
Interleukin-4 and Interleukin-13 signaling
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
RUNX3 regulates BCL2L11 (BIM) transcription
Regulation of localization of FOXO transcription factors
FOXO-mediated transcription of cell death genes
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Regulation of FOXO transcriptional activity by acetylation
FOXO-mediated transcription of cell cycle genes
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Choroid plexus carcinoma other rs1554209779 RCV000505594
Medulloblastoma other rs1554218944 RCV000505635
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 28139510
Adenocarcinoma of Lung Inhibit 24014251
Adenocarcinoma of Lung Associate 24766860, 25743813
Alzheimer Disease Associate 34475505, 36988771, 37483002
Amyloidosis Associate 37039144
Anemia Sickle Cell Associate 29884740
Arthritis Rheumatoid Associate 30429437, 30679758, 35008549
Arthritis Rheumatoid Inhibit 39498523, 40238799
Asthma Associate 29141605, 33298101, 35501805, 36675122
Ataxia Telangiectasia Associate 37345209