Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2309
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box O3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXO3
Synonyms (NCBI Gene) Gene synonyms aliases
AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000671 hsa-miR-182-5p Luciferase reporter assay, Western blot 19188590
MIRT000671 hsa-miR-182-5p Luciferase reporter assay, Western blot 19188590
MIRT000671 hsa-miR-182-5p Review 19935707
MIRT004495 hsa-miR-155-5p qRT-PCR, Luciferase reporter assay, Western blot 20371610
MIRT000434 hsa-miR-221-3p qRT-PCR, ChIP, Luciferase reporter assay, Western blot, Northern blot 20388878
Transcription factors
Transcription factor Regulation Reference
ABL1 Activation 15509806
NFKB1 Unknown 19299143
RELA Unknown 19299143
SIRT1 Repression 17558024;21841822
SIRT3 Unknown 23665396
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 20371612
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18787191
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding ISS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602681 3821 ENSG00000118689
Protein
UniProt ID O43524
Protein name Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma-like 1)
Protein function Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy (PubMed:10102273, PubMed:16751106, PubMed:21329882, PubMed:30513302). Acts as a positi
PDB 2K86 , 2LQH , 2LQI , 2UZK , 6MNL , 7V9B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 157 244 Forkhead domain Domain
PF16675 FOXO_KIX_bdg 432 511 KIX-binding domain of forkhead box O, CR2 Family
PF16676 FOXO-TAD 604 645 Transactivation domain of FOXO protein family Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9479491}.
Sequence
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSG
KAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVML
RNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG
Sequence length 673
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
Chemokine signaling pathway
FoxO signaling pathway
Mitophagy - animal
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Neurotrophin signaling pathway
Prolactin signaling pathway
Alcoholic liver disease
Shigellosis
Chemical carcinogenesis - reactive oxygen species
Endometrial cancer
Non-small cell lung cancer
  Signaling by NODAL
AKT phosphorylates targets in the nucleus
Constitutive Signaling by AKT1 E17K in Cancer
MAPK6/MAPK4 signaling
Interleukin-4 and Interleukin-13 signaling
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
RUNX3 regulates BCL2L11 (BIM) transcription
Regulation of localization of FOXO transcription factors
FOXO-mediated transcription of cell death genes
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Regulation of FOXO transcriptional activity by acetylation
FOXO-mediated transcription of cell cycle genes
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 23685749
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)
19380174
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)
19380174
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)
23954404
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 23099361 ClinVar
Crohn disease Crohn Disease 28067912 ClinVar
Crohn Disease Crohn Disease GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 28139510
Adenocarcinoma of Lung Inhibit 24014251
Adenocarcinoma of Lung Associate 24766860, 25743813
Alzheimer Disease Associate 34475505, 36988771, 37483002
Amyloidosis Associate 37039144
Anemia Sickle Cell Associate 29884740
Arthritis Rheumatoid Associate 30429437, 30679758, 35008549
Arthritis Rheumatoid Inhibit 39498523, 40238799
Asthma Associate 29141605, 33298101, 35501805, 36675122
Ataxia Telangiectasia Associate 37345209