Gene Gene information from NCBI Gene database.
Entrez ID 23089
Gene name Paternally expressed 10
Gene symbol PEG10
Synonyms (NCBI Gene)
EDRHB-1MEF3LMar2Mart2RGAG3RTL2SIRH1
Chromosome 7
Chromosome location 7q21.3
Summary This is a paternally expressed imprinted gene that is thought to have been derived from the Ty3/Gypsy family of retrotransposons. It contains two overlapping open reading frames, RF1 and RF2, and expresses two proteins: a shorter, gag-like protein (with a
miRNA miRNA information provided by mirtarbase database.
854
miRTarBase ID miRNA Experiments Reference
MIRT046911 hsa-miR-221-3p CLASH 23622248
MIRT045728 hsa-miR-125a-5p CLASH 23622248
MIRT045223 hsa-miR-186-5p CLASH 23622248
MIRT041877 hsa-miR-484 CLASH 23622248
MIRT041310 hsa-miR-193b-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
E2F1 Unknown 18625225
E2F4 Unknown 18625225
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609810 14005 ENSG00000242265
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86TG7
Protein name Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotran
Protein function Retrotransposon-derived protein that binds its own mRNA and self-assembles into virion-like capsids (PubMed:34413232). Forms virion-like extracellular vesicles that encapsulate their own mRNA and are released from cells, enabling intercellular t
PDB 7LGA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16297 DUF4939 62 165 Domain of unknown function (DUF4939) Family
PF08284 RVP_2 360 470 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the cytotrophoblast layer but not in the overlying syncytiotrophoblast of the placenta. Expressed in prostate and breast carcinomas but not in normal breast and prostate epithelial cells. Expressed in the Hep-G2 cell line
Sequence
MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIE
LRGAAAAAAPPPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCF
VTSMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRRE
VAKRKIRRLRQGMGS
VIDYSNAFQMIAQDLDWNEPALIDQYHEGLSDHIQEELSHLEVAKSLSALIGQCIHIERR
LARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGT
GGHYADNCPAKASKSSPAGKLPGPAVEGPSATGPEIIRSPQDDASSPHLQVMLQIHLPGR
HTLFVRAMIDSGASGNFIDHEYVAQNGIPLRIKDWPILVEAIDGRPIASGPVVHETHDLI
VDLGDHREVLSFDVTQSPFFPVVLGVRWLSTHDPNITWSTRSIVFDSEYC
RYHCRMYSPI
PPSLPPPAPQPPLYYPVDGYRVYQPVRYYYVQNVYTPVDEHVYPDHRLVDPHIEMIPGAH
SIPSGHVYSLSEPEMAALRDFVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAP
NNFTIQNQYPRLSIPNLEDQAHLATYTEFVPQIPGYQTYPTYAAYPTYPVGFAWYPVGRD
GQGRSLYVPVMITWNPHWYRQPPVPQYPPPQPPPPPPPPPPPPSYSTL
Sequence length 708
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Abortion Spontaneous Associate 20484977
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Stimulate 21455631
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of Lung Associate 31854219
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Inhibit 39518916
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Associate 36951542
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Associate 21455631
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 21455631
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 17006932, 18625225, 21767414, 25687862, 30450735, 32826862
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Stimulate 20084274, 24369324
★☆☆☆☆
Found in Text Mining only
Carcinoma Intraductal Noninfiltrating Associate 28178722
★☆☆☆☆
Found in Text Mining only