Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23081
Gene name Gene Name - the full gene name approved by the HGNC.	Lysine demethylase 4C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KDM4C
Synonyms (NCBI Gene) Gene synonyms aliases	GASC1, JHDM3C, JMJD2C, TDRD14C
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p24.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016783	hsa-miR-335-5p	Microarray	18185580
MIRT440401	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440400	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT440401	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440400	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT1084581	hsa-miR-3689a-5p	CLIP-seq
MIRT1084582	hsa-miR-3689b	CLIP-seq
MIRT1084583	hsa-miR-3689e	CLIP-seq
MIRT1084584	hsa-miR-3689f	CLIP-seq
MIRT1084585	hsa-miR-4291	CLIP-seq
MIRT1084586	hsa-miR-545	CLIP-seq
MIRT1084587	hsa-miR-556-5p	CLIP-seq
MIRT737734	hsa-miR-4765	CLIP-seq
MIRT737735	hsa-miR-5096	CLIP-seq
MIRT1084588	hsa-miR-1178	CLIP-seq
MIRT1084589	hsa-miR-1324	CLIP-seq
MIRT1084590	hsa-miR-216a	CLIP-seq
MIRT1084591	hsa-miR-335	CLIP-seq
MIRT1084592	hsa-miR-3613-3p	CLIP-seq
MIRT1084593	hsa-miR-3686	CLIP-seq
MIRT1084594	hsa-miR-4272	CLIP-seq
MIRT1084595	hsa-miR-4277	CLIP-seq
MIRT1084596	hsa-miR-4282	CLIP-seq
MIRT1084597	hsa-miR-4457	CLIP-seq
MIRT1084598	hsa-miR-4495	CLIP-seq
MIRT1084599	hsa-miR-451b	CLIP-seq
MIRT1084600	hsa-miR-4696	CLIP-seq
MIRT1084601	hsa-miR-4719	CLIP-seq
MIRT1084602	hsa-miR-4753-5p	CLIP-seq
MIRT1084603	hsa-miR-513a-3p	CLIP-seq
MIRT1084604	hsa-miR-513b	CLIP-seq
MIRT1084605	hsa-miR-513c	CLIP-seq
MIRT1084606	hsa-miR-514b-5p	CLIP-seq
MIRT1084607	hsa-miR-548n	CLIP-seq
MIRT1084608	hsa-miR-548t	CLIP-seq
MIRT1084609	hsa-miR-579	CLIP-seq
MIRT1084610	hsa-miR-599	CLIP-seq
MIRT1084611	hsa-miR-602	CLIP-seq
MIRT1084612	hsa-miR-624	CLIP-seq
MIRT1084613	hsa-miR-767-3p	CLIP-seq
MIRT737734	hsa-miR-4765	CLIP-seq
MIRT737735	hsa-miR-5096	CLIP-seq
MIRT2442292	hsa-miR-4268	CLIP-seq
MIRT2442293	hsa-miR-4448	CLIP-seq
MIRT2442294	hsa-miR-4694-5p	CLIP-seq
MIRT2452337	hsa-miR-1236	CLIP-seq
MIRT2452338	hsa-miR-4768-5p	CLIP-seq
MIRT2452339	hsa-miR-942	CLIP-seq
MIRT2555923	hsa-miR-1281	CLIP-seq
MIRT2555924	hsa-miR-3144-5p	CLIP-seq
MIRT2555925	hsa-miR-3918	CLIP-seq
MIRT1084597	hsa-miR-4457	CLIP-seq
MIRT2555923	hsa-miR-1281	CLIP-seq
MIRT2555924	hsa-miR-3144-5p	CLIP-seq
MIRT2555925	hsa-miR-3918	CLIP-seq
MIRT1084597	hsa-miR-4457	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	17277772
GO:0003682	Function	Chromatin binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0006338	Process	Chromatin remodeling	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	17277772
GO:0008270	Function	Zinc ion binding	IDA	21914792
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	17277772
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019899	Function	Enzyme binding	IPI	17277772
GO:0032452	Function	Histone demethylase activity	EXP	18066052
GO:0032452	Function	Histone demethylase activity	IBA	21873635
GO:0032454	Function	Histone demethylase activity (H3-K9 specific)	IBA	21873635
GO:0032454	Function	Histone demethylase activity (H3-K9 specific)	IDA	18066052, 21914792
GO:0032454	Function	Histone demethylase activity (H3-K9 specific)	IMP	17277772, 28262558
GO:0033169	Process	Histone H3-K9 demethylation	IDA	18066052, 21914792
GO:0033169	Process	Histone H3-K9 demethylation	IMP	17277772, 28262558
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0050681	Function	Androgen receptor binding	IPI	17277772
GO:0051864	Function	Histone demethylase activity (H3-K36 specific)	IBA	21873635
GO:0051864	Function	Histone demethylase activity (H3-K36 specific)	IDA	21914792
GO:0070544	Process	Histone H3-K36 demethylation	IDA	21914792

MIM	HGNC	e!Ensembl
605469	17071	ENSG00000107077

Protein

UniProt ID

Q9H3R0

Protein name

Lysine-specific demethylase 4C (EC 1.14.11.66) (Gene amplified in squamous cell carcinoma 1 protein) (GASC-1 protein) (JmjC domain-containing histone demethylation protein 3C) (Jumonji domain-containing protein 2C) ([histone H3]-trimethyl-L-lysine(9) deme

Protein function

Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 '

PDB

2XDP , 2XML , 4XDO , 4XDP , 5FJH , 5FJK , 5KR7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02375	JmjN	17 → 51	jmjN domain	Family
PF02373	JmjC	177 → 293	JmjC domain, hydroxylase	Domain
PF13831	PHD_2	712 → 747		Family
PF13832	zf-HC5HC2H_2	753 → 864		Domain
PF18104	Tudor_2	882 → 916	Jumonji domain-containing protein 2A Tudor domain	Domain
PF18104	Tudor_2	940 → 974	Jumonji domain-containing protein 2A Tudor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in several esophageal squamous cell carcinomas (ESCs). {ECO:0000269|PubMed:10987278}.

Sequence

MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ

Sequence length

1056

Interactions

View interactions

	Reactome
			HDMs demethylate histones Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	19270706
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	29438700
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	30285260, 28991256

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Restless Legs Syndrome	Restless Legs Syndrome		GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining
Autism Spectrum Disorder	Associate	33279929
Breast Neoplasms	Associate	21666724, 23148692, 24952432, 25220908, 27223606
Carcinogenesis	Associate	27223606, 31888886
Carcinoma Non Small Cell Lung	Associate	26722485
Carcinoma Renal Cell	Associate	22483639, 25220908, 31575031
Carcinoma Squamous Cell	Associate	11346465, 21666724, 24394434
Esophageal Neoplasms	Associate	19339270
Fetal Growth Retardation	Associate	31415216
Glioblastoma	Stimulate	31888886
Glioma	Associate	31888886
Hereditary leiomyomatosis and renal cell cancer	Associate	26160878
Hodgkin Disease	Associate	21156283, 35522148
Hypoxia Brain	Stimulate	26160878
Infertility Male	Associate	31103287
Latent Autoimmune Diabetes in Adults	Associate	28396876
Leukemia	Associate	25220908
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20082691
Lymphoma	Associate	21156283, 26850007, 35522148
Lymphoma B Cell	Associate	21156283, 35522148
Melanoma	Associate	38252669
Multiple Myeloma	Stimulate	33469678
Neoplasms	Associate	21666724, 23148692, 24285722, 24952432, 25220908, 26850007, 27223606, 34281993
Neoplasms	Inhibit	35522148
Ovarian Neoplasms	Associate	26864203, 36804120
Prostatic Neoplasms	Associate	25220908
Schizophrenia	Associate	33279929
Stomach Neoplasms	Associate	37848946

KDM4C (lysine demethylase 4C)