FOXM1 (forkhead box M1)

Gene

• Entrez ID: 2305
• Gene name: Forkhead box M1
• Gene symbol: FOXM1
• Synonyms (NCBI Gene): FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TRIDENT
• Chromosome: 12
• Chromosome location: 12p13.33
• Summary: The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006979	hsa-miR-134-5p	Luciferase reporter assay, Western blot	23010597
MIRT006979	hsa-miR-134-5p	Luciferase reporter assay, Western blot	23010597
MIRT030070	hsa-miR-26b-5p	Microarray	19088304
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, Western blot	23762558
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, Western blot	23762558
MIRT045084	hsa-miR-186-5p	CLASH	23622248
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay	24055400
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23576572
MIRT053766	hsa-miR-194-5p	Immunofluorescence, qRT-PCR, Western blot	24748184
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, Western blot	22900969
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, Western blot	22900969
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617733
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617733
MIRT731927	hsa-miR-320a	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27086911
MIRT731927	hsa-miR-320a	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27086911
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, qRT-PCR, Western blot	27415661
MIRT732579	hsa-miR-4521	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33407516
MIRT732579	hsa-miR-4521	FACS, Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	31541075
MIRT734491	hsa-miR-552-3p	ChIP-seq, Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33867818
MIRT735071	hsa-miR-21-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32782495
MIRT737073	hsa-miR-215-3p	Luciferase reporter assay, qRT-PCR, in vivo gain/loss-of-function experiments	31607224
MIRT737214	hsa-miR-4756-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31554904
MIRT737393	hsa-miR-1179	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA-seq, qRT-PCR	31951855
MIRT737413	hsa-miR-134-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31934035
MIRT755522	hsa-miR-637	Luciferase reporter assay, Western blotting, qRT-PCR	34519627
MIRT755696	hsa-miR-320b	Luciferase reporter assay, Western blotting, Northern blotting, qRT-PCR, in vitro cullelar assays, In situ hybridization, RNA pull down assay	33782807
MIRT755850	hsa-miR-325-3P	Luciferase reporter assay, Western blotting, qRT-PCR	34997725
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1002498	hsa-miR-1185	CLIP-seq
MIRT1002499	hsa-miR-1270	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1002501	hsa-miR-3167	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1002503	hsa-miR-3620	CLIP-seq
MIRT1002504	hsa-miR-3679-5p	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT1002506	hsa-miR-4434	CLIP-seq
MIRT1002507	hsa-miR-4516	CLIP-seq
MIRT1002508	hsa-miR-4531	CLIP-seq
MIRT1002509	hsa-miR-4659a-3p	CLIP-seq
MIRT1002510	hsa-miR-4659b-3p	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002512	hsa-miR-4778-3p	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1002515	hsa-miR-548u	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1002517	hsa-miR-620	CLIP-seq
MIRT1002518	hsa-miR-876-5p	CLIP-seq
MIRT1002519	hsa-miR-877	CLIP-seq
MIRT1997136	hsa-miR-1193	CLIP-seq
MIRT1997137	hsa-miR-1207-3p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997141	hsa-miR-1285	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1997146	hsa-miR-214	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1997147	hsa-miR-3135	CLIP-seq
MIRT1997148	hsa-miR-3138	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997150	hsa-miR-3165	CLIP-seq
MIRT1997151	hsa-miR-3170	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT1997153	hsa-miR-3187-5p	CLIP-seq
MIRT1997154	hsa-miR-3188	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1997158	hsa-miR-342-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1997159	hsa-miR-3619-5p	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997161	hsa-miR-371b-3p	CLIP-seq
MIRT1997162	hsa-miR-378g	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1997164	hsa-miR-3977	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997166	hsa-miR-4257	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997169	hsa-miR-4272	CLIP-seq
MIRT1997170	hsa-miR-4300	CLIP-seq
MIRT1997171	hsa-miR-4317	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997174	hsa-miR-4468	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997176	hsa-miR-4486	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997179	hsa-miR-4520a-3p	CLIP-seq
MIRT1997180	hsa-miR-4633-3p	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997182	hsa-miR-4651	CLIP-seq
MIRT1997183	hsa-miR-4664-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1997188	hsa-miR-4731-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997191	hsa-miR-4747-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997194	hsa-miR-4772-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT1997196	hsa-miR-4777-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997201	hsa-miR-548ag	CLIP-seq
MIRT1997202	hsa-miR-548ai	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1997204	hsa-miR-608	CLIP-seq
MIRT1997205	hsa-miR-612	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq
MIRT1997208	hsa-miR-761	CLIP-seq
MIRT1997209	hsa-miR-920	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT2230953	hsa-miR-1207-5p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT2230954	hsa-miR-1321	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT2230955	hsa-miR-361-5p	CLIP-seq
MIRT2230956	hsa-miR-3689d	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT2230957	hsa-miR-3919	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT2230958	hsa-miR-4261	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT2230959	hsa-miR-4728-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT2230960	hsa-miR-4739	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT2230961	hsa-miR-4756-5p	CLIP-seq
MIRT2230962	hsa-miR-4763-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT2230963	hsa-miR-4774-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT2230964	hsa-miR-494	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATM	Activation	21518729
E2F1	Activation	21518729
FLI1	Activation	23365673
FOXO3	Repression	19276163
MYC	Activation	20658516
SP1	Activation	20372080
TP53	Repression	21518729

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20531406
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	21860419
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IDA	9032290
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9242644
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9032290, 10523841
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9441747
GO:0005515	Function	Protein binding	IPI	10523841, 16504183, 16809346, 22014570, 22094256, 25609649, 26871637, 31134895, 33754036
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19696738
GO:0019901	Function	Protein kinase binding	IPI	19160488
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IMP	17101782
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IMP	19696738
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042127	Process	Regulation of cell population proliferation	NAS	9441747
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9032290, 10523841
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17101782, 20531406
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20531406
GO:0046578	Process	Regulation of Ras protein signal transduction	IMP	19696738
GO:0051726	Process	Regulation of cell cycle	IMP	19696738
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IMP	19696738
GO:2000781	Process	Positive regulation of double-strand break repair	IMP	17101782

Other IDs

• MIM: 602341
• HGNC: 3818
• e!Ensembl: ENSG00000111206

Protein

• UniProt ID: Q08050
• Protein name: Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix fac
• Protein function: Transcription factor regulating the expression of cell cycle genes essential for DNA replication and mitosis (PubMed:19160488, PubMed:20360045). Plays a role in the control of cell proliferation (PubMed:19160488). Also plays a role in DNA break
• PDB: 3G73, 7FJ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	235 → 319	Forkhead domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derive
• Sequence:

  MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
  GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
  LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
  LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
  YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
  ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
  LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
  PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
  SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
  RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
  PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
  TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
  GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

• Sequence length: 763

Pathways

KEGG:

Cellular senescence

Reactome:

Polo-like kinase mediated events
Cyclin A/B1/B2 associated events during G2/M transition