Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2305
Gene name Gene Name - the full gene name approved by the HGNC.	Forkhead box M1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOXM1
Synonyms (NCBI Gene) Gene synonyms aliases	FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TRIDENT
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript

Show/Hide all(238)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006979	hsa-miR-134-5p	Luciferase reporter assay, Western blot	23010597
MIRT006979	hsa-miR-134-5p	Luciferase reporter assay, Western blot	23010597
MIRT030070	hsa-miR-26b-5p	Microarray	19088304
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, Western blot	23762558
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, Western blot	23762558
MIRT045084	hsa-miR-186-5p	CLASH	23622248
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay	24055400
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23576572
MIRT053766	hsa-miR-194-5p	Immunofluorescence, qRT-PCR, Western blot	24748184
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, Western blot	22900969
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, Western blot	22900969
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617733
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617733
MIRT731927	hsa-miR-320a	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27086911
MIRT731927	hsa-miR-320a	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27086911
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, qRT-PCR, Western blot	27415661
MIRT732579	hsa-miR-4521	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33407516
MIRT732579	hsa-miR-4521	FACS, Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	31541075
MIRT734491	hsa-miR-552-3p	ChIP-seq, Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33867818
MIRT735071	hsa-miR-21-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32782495
MIRT737073	hsa-miR-215-3p	Luciferase reporter assay, qRT-PCR, in vivo gain/loss-of-function experiments	31607224
MIRT737214	hsa-miR-4756-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31554904
MIRT737393	hsa-miR-1179	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA-seq, qRT-PCR	31951855
MIRT737413	hsa-miR-134-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31934035
MIRT755522	hsa-miR-637	Luciferase reporter assay, Western blotting, qRT-PCR	34519627
MIRT755696	hsa-miR-320b	Luciferase reporter assay, Western blotting, Northern blotting, qRT-PCR, in vitro cullelar assays, In situ hybridization, RNA pull down assay	33782807
MIRT755850	hsa-miR-325-3P	Luciferase reporter assay, Western blotting, qRT-PCR	34997725
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1002498	hsa-miR-1185	CLIP-seq
MIRT1002499	hsa-miR-1270	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1002501	hsa-miR-3167	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1002503	hsa-miR-3620	CLIP-seq
MIRT1002504	hsa-miR-3679-5p	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT1002506	hsa-miR-4434	CLIP-seq
MIRT1002507	hsa-miR-4516	CLIP-seq
MIRT1002508	hsa-miR-4531	CLIP-seq
MIRT1002509	hsa-miR-4659a-3p	CLIP-seq
MIRT1002510	hsa-miR-4659b-3p	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002512	hsa-miR-4778-3p	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1002515	hsa-miR-548u	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1002517	hsa-miR-620	CLIP-seq
MIRT1002518	hsa-miR-876-5p	CLIP-seq
MIRT1002519	hsa-miR-877	CLIP-seq
MIRT1997136	hsa-miR-1193	CLIP-seq
MIRT1997137	hsa-miR-1207-3p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997141	hsa-miR-1285	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1997146	hsa-miR-214	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1997147	hsa-miR-3135	CLIP-seq
MIRT1997148	hsa-miR-3138	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997150	hsa-miR-3165	CLIP-seq
MIRT1997151	hsa-miR-3170	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT1997153	hsa-miR-3187-5p	CLIP-seq
MIRT1997154	hsa-miR-3188	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1997158	hsa-miR-342-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1997159	hsa-miR-3619-5p	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997161	hsa-miR-371b-3p	CLIP-seq
MIRT1997162	hsa-miR-378g	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1997164	hsa-miR-3977	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997166	hsa-miR-4257	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997169	hsa-miR-4272	CLIP-seq
MIRT1997170	hsa-miR-4300	CLIP-seq
MIRT1997171	hsa-miR-4317	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997174	hsa-miR-4468	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997176	hsa-miR-4486	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997179	hsa-miR-4520a-3p	CLIP-seq
MIRT1997180	hsa-miR-4633-3p	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997182	hsa-miR-4651	CLIP-seq
MIRT1997183	hsa-miR-4664-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1997188	hsa-miR-4731-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997191	hsa-miR-4747-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997194	hsa-miR-4772-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT1997196	hsa-miR-4777-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997201	hsa-miR-548ag	CLIP-seq
MIRT1997202	hsa-miR-548ai	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1997204	hsa-miR-608	CLIP-seq
MIRT1997205	hsa-miR-612	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq
MIRT1997208	hsa-miR-761	CLIP-seq
MIRT1997209	hsa-miR-920	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT2230953	hsa-miR-1207-5p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT2230954	hsa-miR-1321	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT2230955	hsa-miR-361-5p	CLIP-seq
MIRT2230956	hsa-miR-3689d	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT2230957	hsa-miR-3919	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT2230958	hsa-miR-4261	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT2230959	hsa-miR-4728-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT2230960	hsa-miR-4739	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT2230961	hsa-miR-4756-5p	CLIP-seq
MIRT2230962	hsa-miR-4763-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT2230963	hsa-miR-4774-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT2230964	hsa-miR-494	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
ATM	Activation	21518729
E2F1	Activation	21518729
FLI1	Activation	23365673
FOXO3	Repression	19276163
MYC	Activation	20658516
SP1	Activation	20372080
TP53	Repression	21518729

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20531406
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	21860419
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003700	Function	DNA-binding transcription factor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16504183, 16809346, 22014570, 25609649, 26871637
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006978	Process	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IMP	17101782
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19696738
GO:0019901	Function	Protein kinase binding	IPI	19160488
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IMP	19696738
GO:0042127	Process	Regulation of cell population proliferation	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	20531406
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	17101782, 20531406
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20531406
GO:0046578	Process	Regulation of Ras protein signal transduction	IMP	19696738
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0071156	Process	Regulation of cell cycle arrest	IBA	21873635
GO:0071156	Process	Regulation of cell cycle arrest	IMP	19696738
GO:0090344	Process	Negative regulation of cell aging	IMP	19696738
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IMP	19696738
GO:2000781	Process	Positive regulation of double-strand break repair	IMP	17101782

MIM	HGNC	e!Ensembl
602341	3818	ENSG00000111206

Protein

UniProt ID

Q08050

Protein name

Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix fac

Protein function

Transcription factor regulating the expression of cell cycle genes essential for DNA replication and mitosis (PubMed:19160488, PubMed:20360045). Plays a role in the control of cell proliferation (PubMed:19160488). Also plays a role in DNA break

PDB

3G73 , 7FJ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	235 → 319	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derive

Sequence

MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

Sequence length

763

Interactions

View interactions

	KEGG		Reactome
	Cellular senescence		Polo-like kinase mediated events Cyclin A/B1/B2 associated events during G2/M transition

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	20208560
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	20208560
Glomerulonephritis	IGA Glomerulonephritis	rs778043831	25133636
Leukemia	leukemia	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	19436953
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	18345025, 19672312
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	16489016, 23255470
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	20208560

Show/Hide Text Mining Associations (163)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	23037713, 25889361, 31180040
Adenocarcinoma in Situ	Stimulate	35008799
Adenocarcinoma Mucinous	Associate	33451982
Adenocarcinoma of Lung	Associate	27494877, 29303511, 31503425, 32294625, 32925947
Adrenocortical Carcinoma	Associate	31783819
Aicardi Syndrome	Associate	31783819
Aneuploidy	Associate	30026603
Arthritis Rheumatoid	Associate	31854447
Astrocytoma	Associate	12937144, 36115056
Breast Neoplasms	Associate	16809346, 18645012, 19276163, 19596828, 20068070, 20208560, 20530690, 21225456, 21860419, 23318431, 23347430, 24362530, 24866763, 24896091, 25213081 View all (27 more)
Breast Neoplasms	Stimulate	18254960
Breast Neoplasms	Inhibit	23372748
Breast Neoplasms Male	Associate	29504520
Calcinosis Cutis	Associate	17430594
Carcinogenesis	Associate	21858223, 23006512, 23325617, 24362530, 25213081, 25897210, 26080399, 27167337, 28148279, 28358012, 28498805, 29303511, 30060118, 32035486, 32514270, 37288663, 37401400 View all (2 more)
Carcinoma	Associate	22271891
Carcinoma Basal Cell	Stimulate	20187950
Carcinoma Hepatocellular	Associate	20154714, 22930530, 25574092, 27383303, 29303511, 29658607, 31886176, 32174012, 32390596, 34087888, 35761036, 35812416, 35887129, 35955438, 37234166, 39596041 View all (1 more)
Carcinoma Hepatocellular	Stimulate	28849004, 34810266, 35013529, 38001498
Carcinoma in Situ	Associate	26415052
Carcinoma Non Small Cell Lung	Stimulate	22447226
Carcinoma Non Small Cell Lung	Associate	23010597, 23167412, 23536876, 25700356, 27035590, 27521795, 30709424, 32228656, 33413028, 35743223, 35756697
Carcinoma Ovarian Epithelial	Associate	24885308, 28482906
Carcinoma Pancreatic Ductal	Associate	34117362
Carcinoma Renal Cell	Associate	23006512, 25579557, 28902136, 29700419, 31422942, 31625200, 31743108, 32249812, 33968297, 34212534
Carcinoma Squamous Cell	Associate	19287496, 27385468, 27409343, 32514270, 37957720
Cardiovascular Diseases	Associate	37681487
Cholangiocarcinoma	Associate	25897210, 30538221
Chromosomal Instability	Stimulate	37452072
Colonic Neoplasms	Associate	30278464, 34790819
Colorectal Neoplasms	Associate	20372080, 25613903, 26264222, 26350748, 27034162, 27415661, 28148279, 29301438, 30728402, 30941959, 33214609, 33291076, 34262080, 34337040, 36591565
Colorectal Neoplasms	Stimulate	25935853
Crohn Disease	Associate	30015893
Death	Associate	23536876, 28498805, 31503425
Diabetes Complications	Associate	37681487
Diabetes Gestational	Associate	35779916
Diabetes Mellitus	Associate	22413961, 35856334, 37681487
Diabetes Mellitus Type 2	Associate	33633681
Diabetic Foot	Associate	35856334
Drug Related Side Effects and Adverse Reactions	Associate	27521795, 33093209
Dysplastic Nevus Syndrome	Associate	36580012
Endometrial Neoplasms	Associate	26193427, 33503056, 37159818, 38646803
Epilepsies Myoclonic	Associate	31445158
Epstein Barr Virus Infections	Associate	33451982
Esophageal Neoplasms	Associate	26722467, 30485581, 32035486
Esophageal Squamous Cell Carcinoma	Associate	21976009, 29877046, 30485581, 34117362, 35639418, 35842667
Familial Primary Pulmonary Hypertension	Associate	25290246
Fibrocartilaginous embolism	Associate	32943704
Gallbladder Neoplasms	Associate	25071344
Gastro enteropancreatic neuroendocrine tumor	Associate	25797272
Gastrointestinal Diseases	Associate	25797272
Genomic Instability	Associate	33253193
Glaucoma	Associate	36833422
Glaucoma Open Angle	Associate	36833422
Glioblastoma	Associate	12937144, 20419098, 22977194, 26085085, 27764801, 28399407, 29039578, 35039475, 38069906, 40725039
Glioma	Associate	23991102, 26085085, 27852048, 28767320, 28784180, 30730955, 34252882, 35013529, 36564758
Glioma	Stimulate	24488909
Graves Ophthalmopathy	Associate	37272763
Head and Neck Neoplasms	Associate	33160365, 35313071
Heart Diseases	Associate	36118675
Hepatitis B	Associate	36795481
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	20187950
Hereditary leiomyomatosis and renal cell cancer	Stimulate	28289076
Hyperplasia	Associate	22461910, 23775078, 31437238
Hypoxia	Stimulate	22033266, 31364741, 34181359
Hypoxia	Associate	38190128
Hypoxia Brain	Associate	37187346
Idiopathic Pulmonary Fibrosis	Associate	29789556, 37653539
Impotence Vasculogenic	Associate	32035486
Inflammation	Associate	23775078, 33297736, 36118675
Insulin Resistance	Associate	37681487
Kidney Diseases	Associate	37681487
Klatskin Tumor	Associate	29776401
Laryngeal Neoplasms	Stimulate	32633370
Leiomyosarcoma	Associate	26560505
Leukemia	Associate	23110199, 26316295, 31122263
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20028985, 24148180, 31122263
Leukemia Myeloid Acute	Associate	22900969, 34711181
Leukemia Myeloid Acute	Inhibit	36481766
Lung Neoplasms	Associate	23167412, 23271813, 30111255, 33099911, 35756697, 36435510, 37236507, 38296976
Lupus Erythematosus Systemic	Stimulate	33633721
Lymphatic Diseases	Associate	29877046
Lymphatic Metastasis	Associate	21858223, 23006512, 23167412, 29360662
Lymphatic Metastasis	Stimulate	23536876, 24885308, 25231007, 25829806, 25935853, 28848994
Lymphoma Follicular	Associate	26589882
Lymphoma Large B Cell Diffuse	Associate	22271891
Lymphoma Non Hodgkin	Associate	33890574, 35624501, 37828118
Mason Type Diabetes	Associate	33633681
Medulloblastoma	Associate	31541075
Melanoma	Stimulate	26279295
Melanoma	Associate	26640950, 30910803, 35138218
Meningioma	Stimulate	28195122, 36115056
Meningioma	Associate	29590631, 33099292, 35570314, 36227281
Mesothelioma	Associate	34859258
Mesothelioma Malignant	Stimulate	19218339
Mesothelioma Malignant	Associate	22761781, 23018647, 34859258
Mouth Neoplasms	Associate	37641028
Multiple Myeloma	Associate	28835615, 35015835
Myelodysplastic Syndromes	Inhibit	36481766
Myopia	Associate	38190128
Nasopharyngeal Carcinoma	Associate	25231007, 28277541, 35656815
Nasopharyngeal Carcinoma	Stimulate	25337187, 30638177
Necrosis	Associate	29343703
Neoplasm Metastasis	Associate	18645012, 23006512, 23325617, 24418574, 24918286, 25213081, 25231007, 25574092, 25797272, 25935853, 26264222, 26617733, 26884854, 27764801, 28849004 View all (13 more)
Neoplasm Metastasis	Stimulate	23536876, 36591565
Neoplasm Metastasis	Inhibit	23775078, 28539830
Neoplasms	Associate	15720800, 18254960, 18573889, 19287496, 19440351, 19596828, 19643405, 19672316, 20068070, 20187950, 20372080, 20386868, 21503965, 21858223, 22033266 View all (109 more)
Neoplasms	Stimulate	19165865, 22361633, 22977194, 23006512, 26084130, 26316295, 28148279, 30942437, 30978209
Neoplasms Adipose Tissue	Associate	25676576
Nervous System Diseases	Associate	37681487
Neuroblastoma	Associate	30451831, 35428820
Non Muscle Invasive Bladder Neoplasms	Associate	28498805, 29959570, 35879690
Osteoarthritis	Associate	33297736, 38218927
Osteogenesis imperfecta type 2A	Associate	29877046
Osteosarcoma	Associate	24282087, 26617733, 28539830, 35356854, 35799265
Ovarian Diseases	Associate	23029477
Ovarian Neoplasms	Associate	21720365, 21858223, 22589409, 24604117, 24885308, 25411964, 27167337, 28416635, 29545475, 31858531, 31987036, 33235818, 33721456, 33890574, 35624501, 37445993 View all (1 more)
Ovarian Neoplasms	Stimulate	24824601
Pancreatic Neoplasms	Associate	20354770, 21503965, 24418574, 32429421, 33867818, 34117362, 35614040, 36622275
Pancreatic Neoplasms	Stimulate	30367545
Papilloma Inverted	Associate	36580012
Papillomavirus Infections	Associate	36580012
Personality Disorders	Associate	33291076
Photosensitivity Disorders	Associate	36118675
Pituitary Neoplasms	Associate	26264222
Polycystic Ovary Syndrome	Stimulate	37473924
Pre Eclampsia	Associate	33502747
Precancerous Conditions	Associate	39428479
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	26316295
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	30646895
Progeria	Associate	30026603
Prostatic Neoplasms	Associate	17430594, 23775078, 28199985, 28677763, 29462661, 29554906, 31225930, 31364741, 34654353, 34864822, 35392496, 36891298
Prostatitis	Associate	23775078
Pulmonary Arterial Hypertension	Associate	22033266, 31437238
Pulmonary Fibrosis	Associate	33601175
Renal Insufficiency	Associate	33960101
Respiratory Distress Syndrome	Associate	27090785
Retinal Dysplasia	Associate	22461910
Retinoblastoma	Associate	30060118, 32152631
Rhabdomyosarcoma	Associate	26553361
Rhabdomyosarcoma Alveolar	Associate	26553361
Rhabdomyosarcoma Embryonal	Associate	26553361
Sarcoma	Associate	26080399, 33564073
Sarcoma Synovial	Associate	27439614
Scleral Diseases	Associate	38190128
Sepsis	Associate	27090785
Sexual Dysfunction Physiological	Associate	25071344
Skin Neoplasms	Associate	20187950
Small Cell Lung Carcinoma	Associate	26871945
Squamous Cell Carcinoma of Head and Neck	Associate	19287496, 22461910, 24114764, 25229973, 26084130, 27409343, 28848994, 29360662, 30942437, 30978209, 33093209, 33255409, 33420101, 33892811, 36801643
Stenosis Pulmonary Artery	Associate	22033266
Stomach Diseases	Associate	36401232
Stomach Neoplasms	Associate	22969238, 24004449, 24204899, 24628949, 26164001, 26261559, 26576650, 26790640, 26831669, 28078605, 28184921, 29424899, 30250169, 30569124, 33451982 View all (4 more)
Systemic Inflammatory Response Syndrome	Associate	37681487
Thyroid Cancer Papillary	Associate	28187428, 39376176
Thyroid Carcinoma Anaplastic	Stimulate	31183379
Thyroid Carcinoma Anaplastic	Associate	32887540, 39376176
Tissue Adhesions	Associate	37385390
Triple Negative Breast Neoplasms	Stimulate	27277416
Triple Negative Breast Neoplasms	Associate	27303043, 29301506, 30305342, 31359594, 33835503, 34206484, 34880209, 35524313, 36424525, 39428479
Urinary Bladder Neoplasms	Associate	23325617, 24999187, 28498805, 29303511, 29397866, 29959570, 34650035, 35685866, 38070277, 39456780
Uterine Cervical Dysplasia	Associate	35008799
Uterine Cervical Neoplasms	Associate	23819460, 24166507, 25066298, 28978307, 29343703, 30720158, 30856345, 31831728, 33235818, 33829064, 35141332, 37272088, 38537385

FOXM1 (forkhead box M1)