Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2305
Gene name Gene Name - the full gene name approved by the HGNC.	Forkhead box M1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOXM1
Synonyms (NCBI Gene) Gene synonyms aliases	FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TRIDENT
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript

Show/Hide all(238)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006979	hsa-miR-134-5p	Luciferase reporter assay, Western blot	23010597
MIRT006979	hsa-miR-134-5p	Luciferase reporter assay, Western blot	23010597
MIRT030070	hsa-miR-26b-5p	Microarray	19088304
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, Western blot	23762558
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, Western blot	23762558
MIRT045084	hsa-miR-186-5p	CLASH	23622248
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay	24055400
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23576572
MIRT053766	hsa-miR-194-5p	Immunofluorescence, qRT-PCR, Western blot	24748184
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, Western blot	22900969
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, Western blot	22900969
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT438246	hsa-miR-24-1-5p	5.0	24999187
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731505	hsa-miR-509-3-5p	Luciferase reporter assay	27035590
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT731927	hsa-miR-320a	Luciferase reporter assay	27086911
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617733
MIRT053073	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617733
MIRT731927	hsa-miR-320a	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27086911
MIRT731927	hsa-miR-320a	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27086911
MIRT052645	hsa-miR-149-5p	Luciferase reporter assay, qRT-PCR, Western blot	27415661
MIRT732579	hsa-miR-4521	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33407516
MIRT732579	hsa-miR-4521	FACS, Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	31541075
MIRT734491	hsa-miR-552-3p	ChIP-seq, Immunohistochemistry (IHC), In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	33867818
MIRT735071	hsa-miR-21-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32782495
MIRT737073	hsa-miR-215-3p	Luciferase reporter assay, qRT-PCR, in vivo gain/loss-of-function experiments	31607224
MIRT737214	hsa-miR-4756-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31554904
MIRT737393	hsa-miR-1179	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA-seq, qRT-PCR	31951855
MIRT737413	hsa-miR-134-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31934035
MIRT755522	hsa-miR-637	Luciferase reporter assay, Western blotting, qRT-PCR	34519627
MIRT755696	hsa-miR-320b	Luciferase reporter assay, Western blotting, Northern blotting, qRT-PCR, in vitro cullelar assays, In situ hybridization, RNA pull down assay	33782807
MIRT755850	hsa-miR-325-3P	Luciferase reporter assay, Western blotting, qRT-PCR	34997725
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1002498	hsa-miR-1185	CLIP-seq
MIRT1002499	hsa-miR-1270	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1002501	hsa-miR-3167	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1002503	hsa-miR-3620	CLIP-seq
MIRT1002504	hsa-miR-3679-5p	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT1002506	hsa-miR-4434	CLIP-seq
MIRT1002507	hsa-miR-4516	CLIP-seq
MIRT1002508	hsa-miR-4531	CLIP-seq
MIRT1002509	hsa-miR-4659a-3p	CLIP-seq
MIRT1002510	hsa-miR-4659b-3p	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002512	hsa-miR-4778-3p	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1002515	hsa-miR-548u	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1002517	hsa-miR-620	CLIP-seq
MIRT1002518	hsa-miR-876-5p	CLIP-seq
MIRT1002519	hsa-miR-877	CLIP-seq
MIRT1997136	hsa-miR-1193	CLIP-seq
MIRT1997137	hsa-miR-1207-3p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1002483	hsa-miR-1237	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1002484	hsa-miR-1261	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997141	hsa-miR-1285	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1997146	hsa-miR-214	CLIP-seq
MIRT1002485	hsa-miR-3128	CLIP-seq
MIRT1997147	hsa-miR-3135	CLIP-seq
MIRT1997148	hsa-miR-3138	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997150	hsa-miR-3165	CLIP-seq
MIRT1997151	hsa-miR-3170	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT1997153	hsa-miR-3187-5p	CLIP-seq
MIRT1997154	hsa-miR-3188	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT1002486	hsa-miR-326	CLIP-seq
MIRT1002487	hsa-miR-330-5p	CLIP-seq
MIRT1997158	hsa-miR-342-5p	CLIP-seq
MIRT1002488	hsa-miR-34a	CLIP-seq
MIRT1002489	hsa-miR-34c-5p	CLIP-seq
MIRT1997159	hsa-miR-3619-5p	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997161	hsa-miR-371b-3p	CLIP-seq
MIRT1997162	hsa-miR-378g	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1997164	hsa-miR-3977	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997166	hsa-miR-4257	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997169	hsa-miR-4272	CLIP-seq
MIRT1997170	hsa-miR-4300	CLIP-seq
MIRT1997171	hsa-miR-4317	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997174	hsa-miR-4468	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997176	hsa-miR-4486	CLIP-seq
MIRT1002490	hsa-miR-449a	CLIP-seq
MIRT1002491	hsa-miR-449b	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997179	hsa-miR-4520a-3p	CLIP-seq
MIRT1997180	hsa-miR-4633-3p	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997182	hsa-miR-4651	CLIP-seq
MIRT1997183	hsa-miR-4664-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT1002511	hsa-miR-4699-3p	CLIP-seq
MIRT1002492	hsa-miR-4720-5p	CLIP-seq
MIRT1002493	hsa-miR-4726-3p	CLIP-seq
MIRT1997188	hsa-miR-4731-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997191	hsa-miR-4747-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997194	hsa-miR-4772-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT1997196	hsa-miR-4777-3p	CLIP-seq
MIRT1002494	hsa-miR-4782-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT1002495	hsa-miR-4793-5p	CLIP-seq
MIRT1002496	hsa-miR-4799-3p	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997201	hsa-miR-548ag	CLIP-seq
MIRT1997202	hsa-miR-548ai	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002497	hsa-miR-593	CLIP-seq
MIRT1997204	hsa-miR-608	CLIP-seq
MIRT1997205	hsa-miR-612	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq
MIRT1997208	hsa-miR-761	CLIP-seq
MIRT1997209	hsa-miR-920	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT2230953	hsa-miR-1207-5p	CLIP-seq
MIRT1002482	hsa-miR-1224-3p	CLIP-seq
MIRT1997138	hsa-miR-1260	CLIP-seq
MIRT1997139	hsa-miR-1260b	CLIP-seq
MIRT1997140	hsa-miR-1280	CLIP-seq
MIRT1997142	hsa-miR-132	CLIP-seq
MIRT2230954	hsa-miR-1321	CLIP-seq
MIRT1997143	hsa-miR-153	CLIP-seq
MIRT1997144	hsa-miR-2114	CLIP-seq
MIRT1997145	hsa-miR-212	CLIP-seq
MIRT1002500	hsa-miR-3125	CLIP-seq
MIRT1997149	hsa-miR-3150b-3p	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1002502	hsa-miR-323b-3p	CLIP-seq
MIRT1997157	hsa-miR-324-5p	CLIP-seq
MIRT2230955	hsa-miR-361-5p	CLIP-seq
MIRT2230956	hsa-miR-3689d	CLIP-seq
MIRT1997160	hsa-miR-370	CLIP-seq
MIRT1997163	hsa-miR-3909	CLIP-seq
MIRT1002505	hsa-miR-3916	CLIP-seq
MIRT2230957	hsa-miR-3919	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT2230958	hsa-miR-4261	CLIP-seq
MIRT1997167	hsa-miR-4269	CLIP-seq
MIRT1997168	hsa-miR-4270	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997173	hsa-miR-4441	CLIP-seq
MIRT1997175	hsa-miR-448	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997178	hsa-miR-4514	CLIP-seq
MIRT1997181	hsa-miR-4645-5p	CLIP-seq
MIRT1997184	hsa-miR-4673	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1997186	hsa-miR-4689	CLIP-seq
MIRT1997187	hsa-miR-4692	CLIP-seq
MIRT2230959	hsa-miR-4728-5p	CLIP-seq
MIRT1997189	hsa-miR-4736	CLIP-seq
MIRT2230960	hsa-miR-4739	CLIP-seq
MIRT1997190	hsa-miR-4742-5p	CLIP-seq
MIRT1997192	hsa-miR-4755-3p	CLIP-seq
MIRT2230961	hsa-miR-4756-5p	CLIP-seq
MIRT2230962	hsa-miR-4763-3p	CLIP-seq
MIRT1997193	hsa-miR-4763-5p	CLIP-seq
MIRT1997195	hsa-miR-4773	CLIP-seq
MIRT2230963	hsa-miR-4774-5p	CLIP-seq
MIRT1997197	hsa-miR-4784	CLIP-seq
MIRT1997198	hsa-miR-4786-3p	CLIP-seq
MIRT2230964	hsa-miR-494	CLIP-seq
MIRT1997199	hsa-miR-507	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997200	hsa-miR-532-3p	CLIP-seq
MIRT1997203	hsa-miR-557	CLIP-seq
MIRT1002516	hsa-miR-602	CLIP-seq
MIRT1997206	hsa-miR-626	CLIP-seq
MIRT1997210	hsa-miR-940	CLIP-seq
MIRT1997152	hsa-miR-3184	CLIP-seq
MIRT755696	hsa-miR-320b	CLIP-seq
MIRT1997155	hsa-miR-320c	CLIP-seq
MIRT1997156	hsa-miR-320d	CLIP-seq
MIRT1997165	hsa-miR-423-5p	CLIP-seq
MIRT1997172	hsa-miR-4429	CLIP-seq
MIRT1997177	hsa-miR-450b-5p	CLIP-seq
MIRT1997185	hsa-miR-4688	CLIP-seq
MIRT1002513	hsa-miR-518a-5p	CLIP-seq
MIRT1002514	hsa-miR-527	CLIP-seq
MIRT1997207	hsa-miR-760	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
ATM	Activation	21518729
E2F1	Activation	21518729
FLI1	Activation	23365673
FOXO3	Repression	19276163
MYC	Activation	20658516
SP1	Activation	20372080
TP53	Repression	21518729

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	19160488
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20531406
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	21860419
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IDA	9032290
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9242644
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9032290, 10523841
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9441747
GO:0005515	Function	Protein binding	IPI	10523841, 16504183, 16809346, 22014570, 22094256, 25609649, 26871637, 31134895, 33754036
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19696738
GO:0019901	Function	Protein kinase binding	IPI	19160488
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IMP	17101782
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IMP	19696738
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042127	Process	Regulation of cell population proliferation	NAS	9441747
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9032290, 10523841
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17101782, 20531406
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20531406
GO:0046578	Process	Regulation of Ras protein signal transduction	IMP	19696738
GO:0051726	Process	Regulation of cell cycle	IMP	19696738
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IMP	19696738
GO:2000781	Process	Positive regulation of double-strand break repair	IMP	17101782

MIM	HGNC	e!Ensembl
602341	3818	ENSG00000111206

Protein

UniProt ID

Q08050

Protein name

Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix fac

Protein function

Transcription factor regulating the expression of cell cycle genes essential for DNA replication and mitosis (PubMed:19160488, PubMed:20360045). Plays a role in the control of cell proliferation (PubMed:19160488). Also plays a role in DNA break

PDB

3G73 , 7FJ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	235 → 319	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derive

Sequence

MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

Sequence length

763

Interactions

View interactions

	KEGG		Reactome
	Cellular senescence		Polo-like kinase mediated events Cyclin A/B1/B2 associated events during G2/M transition

FOXM1 (forkhead box M1)