Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23040
Gene name Gene Name - the full gene name approved by the HGNC.
Myelin transcription factor 1 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYT1L
Synonyms (NCBI Gene) Gene synonyms aliases
MRD39, NZF1, ZC2H2C2, ZC2HC4B, myT1-L
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the zinc finger superfamily of transcription factors whose expression, thus far, has been found only in neuronal tissues. The encoded protein belongs to a novel class of cystein-cystein-histidine-cystein zinc finger proteins
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs869320675 C>T Pathogenic Splice donor variant
rs869320676 A>C Pathogenic Coding sequence variant, stop gained
rs878853045 C>T Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs886041655 C>A Pathogenic Stop gained, coding sequence variant
rs886041858 G>A Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017380 hsa-miR-335-5p Microarray 18185580
MIRT029154 hsa-miR-26b-5p Microarray 19088304
MIRT721408 hsa-miR-501-5p HITS-CLIP 19536157
MIRT721407 hsa-miR-6792-5p HITS-CLIP 19536157
MIRT721406 hsa-miR-4503 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613084 7623 ENSG00000186487
Protein
UniProt ID Q9UL68
Protein name Myelin transcription factor 1-like protein (MyT1-L) (MyT1L)
Protein function Transcription factor that plays a key role in neuronal differentiation by specifically repressing expression of non-neuronal genes during neuron differentiation. In contrast to other transcription repressors that inhibit specific lineages, media
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01530 zf-C2HC 30 58 Zinc finger, C2HC type Family
PF01530 zf-C2HC 505 532 Zinc finger, C2HC type Family
PF01530 zf-C2HC 549 577 Zinc finger, C2HC type Family
PF08474 MYT1 621 872 Myelin transcription factor 1 Family
PF01530 zf-C2HC 904 932 Zinc finger, C2HC type Family
PF01530 zf-C2HC 953 981 Zinc finger, C2HC type Family
PF01530 zf-C2HC 1006 1034 Zinc finger, C2HC type Family
Sequence
MEVDTEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKK
RKTQDKQPQEPAPKRKPFAVKADSSSVDECDDSDGTEDMDEKEEDEGEEYSEDNDEPGDE
DEEDEEGDREEEEEIEEEDEDDDEDGEDVEDEEEEEEEEEEEEEEEENEDHQMNCHNTRI
MQDTEKDDNNNDEYDNYDELVAKSLLNLGKIAEDAAYRARTESEMNSNTSNSLEDDSDKN
ENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENMNDRNYADSMSQQDSRNMNYV
MLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERNPQQNMNIRQH
VRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDDDTTSVNSDRS
EEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKP
KSSDSHVKKPYYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEI
LAMHESVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQA
SDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRA
IAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSSSNLSCGGGSSASSTCSKSSF
DYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDENGTLDLSMNKQ
RPRDSCCPILTPLEPMSPQQQAVMNNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDIT
PEDLDPFQEALEERRYPGEVTIPSPKPKYPQC
KESKKDLITLSGCPLADKSIRSMLATSS
QELKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCD
GQGHITGKYASHRSASGCPLA
AKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSG
SFLTHRSLSGCPRA
TSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNS
QMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHM
DPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV
Sequence length 1186
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Mental retardation Intellectual disability, autosomal dominant 39, intellectual disability rs1553324416, rs1275489527, rs1253072668, rs1558371790, rs869320675, rs869320676, rs1558414255, rs878853045, rs1573483715, rs1573501865, rs886041944, rs1057519560 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Breast Cancer Breast cancer specific mortality in estrogen receptor negative breast cancer N/A N/A GWAS
Colorectal Cancer Overall survival in metastatic stage IV colorectal cancer x oxaliplatin treatment interaction N/A N/A GWAS
Diabetes Type 2 diabetes in childhood cancer survivors, Type 2 diabetes (age of onset) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute cholinergic dysautonomia Associate 29453933
Alzheimer Disease Associate 38554950
Aphasia Associate 24129437
Asthma Associate 35606283
Autism Spectrum Disorder Associate 27824329, 35741772, 38136944
Autistic Disorder Associate 22157634, 27824329, 34748075
Congenital Abnormalities Associate 34748075
Cystitis Interstitial Associate 30973927
Death Associate 24015200
Depressive Disorder Associate 22157634