SV2C (synaptic vesicle glycoprotein 2C)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22987
Gene name Gene Name - the full gene name approved by the HGNC.
Synaptic vesicle glycoprotein 2C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SV2C
Synonyms (NCBI Gene) Gene synonyms aliases
SLC22B3
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q13.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(34)
miRTarBase ID miRNA Experiments Reference
MIRT621947 hsa-miR-6758-5p HITS-CLIP 23824327
MIRT621946 hsa-miR-6856-5p HITS-CLIP 23824327
MIRT621945 hsa-miR-3613-3p HITS-CLIP 23824327
MIRT621944 hsa-miR-520g-5p HITS-CLIP 23824327
MIRT621943 hsa-miR-517-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24240280
GO:0005886 Component Plasma membrane TAS
GO:0006836 Process Neurotransmitter transport IEA
GO:0007268 Process Chemical synaptic transmission IEA
GO:0008021 Component Synaptic vesicle TAS 15217342
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610291 30670 ENSG00000122012
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q496J9
Protein name Synaptic vesicle glycoprotein 2C
Protein function Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles. {ECO:0
PDB 4JRA , 5JLV , 5MOY , 6ES1 , 7UIA , 7UIB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00083 Sugar_tr 117 → 428 Sugar (and other) transporter Family
PF13599 Pentapeptide_4 496 → 573 Pentapeptide repeats (9 copies) Repeat
PF07690 MFS_1 566 → 725 Major Facilitator Superfamily Family
Sequence 
MEDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYP
AGETYNGEANDDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDR
RELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAE
TDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQG
YGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAI
IPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMIL
KLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT
FMRCFNYPVRDNTIKLTIVWFTLSFGYYGLSVWFPDVIKPLQSDEYALLTRNVERDKYAN
FTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDT
VFDNTDFEPYKFIDSEFKNCSFFHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVS
ALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVE
LYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKSIPILLASTVLVCGGLVGLCLPD
TRTQVLM
Sequence length 727
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  ECM-receptor interaction   Toxicity of botulinum toxin type D (BoNT/D)
Toxicity of botulinum toxin type A (BoNT/A)
Toxicity of botulinum toxin type F (BoNT/F)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)		 25117820
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 33588752
Breast Neoplasms Associate 23244111
Cognition Disorders Associate 29324989
Diabetes Gestational Associate 33858444
Epilepsy Associate 33588752
Heredodegenerative Disorders Nervous System Associate 33588752
Hypertension Associate 25117820
Neuroblastoma Associate 33588752
Neurodegenerative Diseases Associate 29324989
Parkinson Disease Associate 33588752, 39973496