AKR7A3 (aldo-keto reductase family 7 member A3)

Gene

• Entrez ID: 22977
• Gene name: Aldo-keto reductase family 7 member A3
• Gene symbol: AKR7A3
• Synonyms (NCBI Gene): AFAR2
• Chromosome: 1
• Chromosome location: 1p36.13
• Summary: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM, Apr 2004]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT776379	hsa-miR-3189-3p	CLIP-seq
MIRT776380	hsa-miR-4251	CLIP-seq
MIRT776381	hsa-miR-4293	CLIP-seq
MIRT776382	hsa-miR-4324	CLIP-seq
MIRT776383	hsa-miR-539	CLIP-seq
MIRT776384	hsa-miR-635	CLIP-seq
MIRT776379	hsa-miR-3189-3p	CLIP-seq
MIRT776380	hsa-miR-4251	CLIP-seq
MIRT776381	hsa-miR-4293	CLIP-seq
MIRT776382	hsa-miR-4324	CLIP-seq
MIRT776383	hsa-miR-539	CLIP-seq
MIRT776384	hsa-miR-635	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21044950, 28514442, 31515488, 32296183, 33961781, 35156780
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS	10383892
GO:0006081	Process	Aldehyde metabolic process	TAS	10383892
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IBA
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IDA	18416522
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IEA
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	TAS	10383892
GO:0009055	Function	Electron transfer activity	TAS	10383892
GO:0009636	Process	Response to toxic substance	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 31515488, 32296183
GO:0046223	Process	Aflatoxin catabolic process	IDA	10383892
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070401	Function	NADP+ binding	ISS

Other IDs

• MIM: 608477
• HGNC: 390
• e!Ensembl: ENSG00000162482

Protein

• UniProt ID: O95154
• Protein name: Aldo-keto reductase family 7 member A3 (EC 1.1.1.2) (AFB1 aldehyde reductase 2) (AFB1-AR 2) (Aflatoxin B1 aldehyde reductase member 3)
• Protein function: Catalyzes the NADPH-dependent reduction of various carbonyl-containing compounds, including aldehydes, ketones, and toxic products from cellular metabolism or environmental exposure. Can reduce the dialdehyde form of aflatoxin B1 (AFB1) into alc
• PDB: 2CLP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	12 → 320	Aldo/keto reductase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in colon, kidney, liver, pancreas, adenocarcinoma and endometrium. {ECO:0000269|PubMed:12879023, ECO:0000269|PubMed:18416522}.
• Sequence:

  MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGG
  LGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTP
  VEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVE
  TELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEH
  HFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLA
  AAEEGPLEPAVVDAFNQAWHLVTHECPNYFR

• Sequence length: 331

Pathways

KEGG:

Metabolism of xenobiotics by cytochrome P450

Reactome:

Aflatoxin activation and detoxification

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	25526449	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Inhibit	36951402	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Associate	34859601	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	36951402	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25526449	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Inhibit	36951402	★☆☆☆☆ Found in Text Mining only