Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22974
Gene name Gene Name - the full gene name approved by the HGNC.	TPX2 microtubule nucleation factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TPX2
Synonyms (NCBI Gene) Gene synonyms aliases	C20orf1, C20orf2, DIL-2, DIL2, FLS353, GD:C20orf1, HCA519, HCTP4, REPP86, p100
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.21

Show/Hide all(123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041448	hsa-miR-193b-3p	CLASH	23622248
MIRT733798	hsa-miR-338-3p	Microarray, qRT-PCR	33789319
MIRT736547	hsa-miR-548a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32857606
MIRT737338	hsa-miR-216b-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32169806
MIRT755887	hsa-miR-29c-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35340555
MIRT1450484	hsa-miR-1266	CLIP-seq
MIRT1450485	hsa-miR-1289	CLIP-seq
MIRT1450486	hsa-miR-1304	CLIP-seq
MIRT1450487	hsa-miR-1323	CLIP-seq
MIRT1450488	hsa-miR-216a	CLIP-seq
MIRT1450489	hsa-miR-216b	CLIP-seq
MIRT1450490	hsa-miR-219-5p	CLIP-seq
MIRT1450491	hsa-miR-2278	CLIP-seq
MIRT1450492	hsa-miR-2467-3p	CLIP-seq
MIRT1450493	hsa-miR-3065-5p	CLIP-seq
MIRT1450494	hsa-miR-3150a-3p	CLIP-seq
MIRT1450495	hsa-miR-3159	CLIP-seq
MIRT1450496	hsa-miR-3160-5p	CLIP-seq
MIRT1450497	hsa-miR-3175	CLIP-seq
MIRT1450498	hsa-miR-3198	CLIP-seq
MIRT1450499	hsa-miR-3622a-5p	CLIP-seq
MIRT1450500	hsa-miR-3664-3p	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450502	hsa-miR-3675-3p	CLIP-seq
MIRT1450503	hsa-miR-3678-3p	CLIP-seq
MIRT1450504	hsa-miR-3713	CLIP-seq
MIRT1450505	hsa-miR-3920	CLIP-seq
MIRT1450506	hsa-miR-4269	CLIP-seq
MIRT1450507	hsa-miR-4282	CLIP-seq
MIRT1450508	hsa-miR-4294	CLIP-seq
MIRT1450509	hsa-miR-4309	CLIP-seq
MIRT1450510	hsa-miR-4317	CLIP-seq
MIRT1450511	hsa-miR-4326	CLIP-seq
MIRT1450512	hsa-miR-4445	CLIP-seq
MIRT1450513	hsa-miR-4464	CLIP-seq
MIRT1450514	hsa-miR-4514	CLIP-seq
MIRT1450515	hsa-miR-4518	CLIP-seq
MIRT1450516	hsa-miR-4660	CLIP-seq
MIRT1450517	hsa-miR-4692	CLIP-seq
MIRT1450518	hsa-miR-4693-3p	CLIP-seq
MIRT1450519	hsa-miR-4699-3p	CLIP-seq
MIRT1450520	hsa-miR-4729	CLIP-seq
MIRT1450521	hsa-miR-4742-5p	CLIP-seq
MIRT1450522	hsa-miR-4748	CLIP-seq
MIRT1450523	hsa-miR-4782-3p	CLIP-seq
MIRT1450524	hsa-miR-4796-3p	CLIP-seq
MIRT1450525	hsa-miR-491-5p	CLIP-seq
MIRT1450526	hsa-miR-508-3p	CLIP-seq
MIRT1450527	hsa-miR-513c	CLIP-seq
MIRT1450528	hsa-miR-514b-5p	CLIP-seq
MIRT1450529	hsa-miR-548e	CLIP-seq
MIRT1450530	hsa-miR-548f	CLIP-seq
MIRT1450531	hsa-miR-548o	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT1450533	hsa-miR-564	CLIP-seq
MIRT1450534	hsa-miR-570	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450536	hsa-miR-651	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq
MIRT1450538	hsa-miR-939	CLIP-seq
MIRT2134659	hsa-miR-1253	CLIP-seq
MIRT1450485	hsa-miR-1289	CLIP-seq
MIRT1450486	hsa-miR-1304	CLIP-seq
MIRT2134660	hsa-miR-181a	CLIP-seq
MIRT2134661	hsa-miR-181b	CLIP-seq
MIRT2134662	hsa-miR-181c	CLIP-seq
MIRT2134663	hsa-miR-181d	CLIP-seq
MIRT1450491	hsa-miR-2278	CLIP-seq
MIRT1450492	hsa-miR-2467-3p	CLIP-seq
MIRT2134664	hsa-miR-299-5p	CLIP-seq
MIRT2134665	hsa-miR-3163	CLIP-seq
MIRT1450498	hsa-miR-3198	CLIP-seq
MIRT2134666	hsa-miR-3614-3p	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450503	hsa-miR-3678-3p	CLIP-seq
MIRT1450504	hsa-miR-3713	CLIP-seq
MIRT2134667	hsa-miR-3919	CLIP-seq
MIRT2134668	hsa-miR-4262	CLIP-seq
MIRT1450508	hsa-miR-4294	CLIP-seq
MIRT1450509	hsa-miR-4309	CLIP-seq
MIRT1450510	hsa-miR-4317	CLIP-seq
MIRT2134669	hsa-miR-433	CLIP-seq
MIRT2134670	hsa-miR-4424	CLIP-seq
MIRT1450513	hsa-miR-4464	CLIP-seq
MIRT2134671	hsa-miR-4528	CLIP-seq
MIRT1450522	hsa-miR-4748	CLIP-seq
MIRT2134672	hsa-miR-4802-3p	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT2134673	hsa-miR-606	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq
MIRT2134660	hsa-miR-181a	CLIP-seq
MIRT2134661	hsa-miR-181b	CLIP-seq
MIRT2134662	hsa-miR-181c	CLIP-seq
MIRT2134663	hsa-miR-181d	CLIP-seq
MIRT2355963	hsa-miR-1972	CLIP-seq
MIRT2134664	hsa-miR-299-5p	CLIP-seq
MIRT2134665	hsa-miR-3163	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450504	hsa-miR-3713	CLIP-seq
MIRT2355964	hsa-miR-3908	CLIP-seq
MIRT2355965	hsa-miR-3936	CLIP-seq
MIRT2355966	hsa-miR-3942-5p	CLIP-seq
MIRT2134668	hsa-miR-4262	CLIP-seq
MIRT1450508	hsa-miR-4294	CLIP-seq
MIRT1450510	hsa-miR-4317	CLIP-seq
MIRT2355967	hsa-miR-4645-5p	CLIP-seq
MIRT1450516	hsa-miR-4660	CLIP-seq
MIRT2355968	hsa-miR-4673	CLIP-seq
MIRT2355969	hsa-miR-4688	CLIP-seq
MIRT1450518	hsa-miR-4693-3p	CLIP-seq
MIRT2355970	hsa-miR-4703-5p	CLIP-seq
MIRT2355971	hsa-miR-4766-3p	CLIP-seq
MIRT2355972	hsa-miR-548t	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq
MIRT2134664	hsa-miR-299-5p	CLIP-seq
MIRT2134665	hsa-miR-3163	CLIP-seq
MIRT1450501	hsa-miR-3667-5p	CLIP-seq
MIRT1450532	hsa-miR-554	CLIP-seq
MIRT1450535	hsa-miR-642b	CLIP-seq
MIRT1450537	hsa-miR-759	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	TAS	9207457
GO:0000922	Component	Spindle pole	IDA	14718566
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	14580337, 17474147, 19357306, 20360068, 21242313, 22110403, 25416956, 25986610, 27837025, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9207457
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	37728657
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	ISS	18663142
GO:0005819	Component	Spindle	TAS	9207457
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007020	Process	Microtubule nucleation	IDA	26414402
GO:0007026	Process	Negative regulation of microtubule depolymerization	IDA	26414402
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	14580337, 18662907, 19801554
GO:0032147	Process	Activation of protein kinase activity	IDA	14580337
GO:0043203	Component	Axon hillock	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	19801554
GO:0045171	Component	Intercellular bridge	IDA
GO:0051301	Process	Cell division	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	37728657
GO:0060236	Process	Regulation of mitotic spindle organization	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	ISS	18663142
GO:0061676	Function	Importin-alpha family protein binding	IDA	26165940
GO:0061676	Function	Importin-alpha family protein binding	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0090307	Process	Mitotic spindle assembly	IDA	19001501
GO:0090307	Process	Mitotic spindle assembly	IDA	26165940, 37728657
GO:0090307	Process	Mitotic spindle assembly	IEA

MIM	HGNC	e!Ensembl
605917	1249	ENSG00000088325

Protein

UniProt ID

Q9ULW0

Protein name

Targeting protein for Xklp2 (Differentially expressed in cancerous and non-cancerous lung cells 2) (DIL-2) (Hepatocellular carcinoma-associated antigen 519) (Hepatocellular carcinoma-associated antigen 90) (Protein fls353) (Restricted expression prolifera

Protein function

Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to s

PDB

1OL5 , 3E5A , 3HA6 , 4C3P , 5LXM , 6BJC , 6VPG , 6VPH , 6VPI , 6VPJ , 6VPL , 6VPM , 6XKA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09041	Aurora-A_bind	1 → 68	Aurora-A binding	Disordered
PF12214	TPX2_importin	361 → 489	Cell cycle regulated microtubule associated protein	Family
PF06886	TPX2	540 → 592	Targeting protein for Xklp2 (TPX2) domain	Domain
PF06886	TPX2	660 → 740	Targeting protein for Xklp2 (TPX2) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung carcinoma cell lines but not in normal lung tissues.

Sequence

MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTP
LRKANLQQAIVTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRR
SLRLSAQKDLEQKEKHHVKMKAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTA
EKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEVVEMRKKNEEFKKLAL
AGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKG
CTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDDINLLPSKSSV
TKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLP
ITVPKSPAFALKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSF
DSRDKERQLQKEKKIKELQKGEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRR
GALKAQTWKHQLEEELRQQKEAACFKARPNTVISQEPFVPKKEKKSVAEGLSGSLVQEPF
QLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQKKEELARLRRELVHKANPIRK
YQGLEIKSSDQPLTVPVSPKFSTRFHC

Sequence length

747

Interactions

View interactions

	Reactome
			Regulation of TP53 Activity through Phosphorylation AURKA Activation by TPX2

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (58)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	23357462, 30588191, 33029085, 33126397, 34734491, 36304254, 37768502, 38266813
Breast Neoplasms	Associate	23468873, 25830658, 29138345, 31285741, 31799669, 33499770, 33622270, 34384030, 36930083, 38643462
Carcinogenesis	Associate	25632068, 33029085
Carcinoma Hepatocellular	Stimulate	12097419
Carcinoma Hepatocellular	Associate	32722976, 33102593, 34257537, 36120772, 36204642, 36304254, 36707511
Carcinoma Non Small Cell Lung	Associate	15983384, 28101582, 31775549, 31816603, 32748897, 36202977
Carcinoma Ovarian Epithelial	Associate	24625450
Carcinoma Pancreatic Ductal	Associate	15983384, 29483831, 37142730
Carcinoma Renal Cell	Associate	28260099, 32309427, 32626756, 33154194, 34606125, 35896362
Carcinoma Renal Cell	Stimulate	40362354
Carcinoma Squamous Cell	Associate	15983384
Chromosomal Instability	Associate	33622270
Chromosome Aberrations	Associate	19801554
Colonic Neoplasms	Associate	37770979
Colorectal Neoplasms	Stimulate	10601642
Colorectal Neoplasms	Associate	25632068, 34577783, 37770979
Death	Stimulate	33499770
Dermatitis Contact	Associate	33318199
DNA Repair Deficiency Disorders	Associate	38124367
Drug Hypersensitivity	Associate	33318199
Endometrial Neoplasms	Associate	32705231, 33859719, 35356748, 36304254, 39596419
Esophageal Neoplasms	Associate	26279431, 32443386
Esophageal Squamous Cell Carcinoma	Associate	37083097
Gastrointestinal Stromal Tumors	Associate	31553483
Glioma	Associate	25275596
Head and Neck Neoplasms	Associate	33160365
Hepatitis B	Associate	33102593, 36204642
Hereditary Breast and Ovarian Cancer Syndrome	Associate	25830658
Hereditary leiomyomatosis and renal cell cancer	Associate	16056247
Lung Neoplasms	Associate	32831194
Lymphatic Metastasis	Stimulate	23873098, 24488334, 28069036
Lymphoma Large B Cell Diffuse	Associate	24223200
Meningioma	Associate	21157382
Mesothelioma Malignant	Associate	18384222
Neoplasm Invasiveness	Associate	26279431
Neoplasm Metastasis	Stimulate	28069036, 32748897
Neoplasm Metastasis	Associate	29620263, 31285741, 40362354
Neoplasms	Associate	19801554, 23873098, 24488334, 25401333, 27314162, 29865033, 30177840, 30588191, 30665374, 32442913, 33029085, 33285774, 33622270, 33648511, 33907841 View all (12 more)
Neoplasms	Stimulate	28069036, 32705231
Neoplasms Basal Cell	Stimulate	33285774
Neoplasms Cystic Mucinous and Serous	Associate	24625450
Neoplasms Mesothelial	Associate	18384222
Neuroblastoma	Associate	31557970
Osteochondritis	Associate	31758856
Ovarian Diseases	Associate	23029477, 33907841
Ovarian Neoplasms	Associate	20386695, 29620263, 29865033, 33907841
Pancreatic Neoplasms	Associate	29483831, 33648511, 37142730, 38124367
Personality Disorders	Associate	21157382, 33622270
Prostatic Neoplasms	Associate	22761906, 23333597, 33934205, 36834602, 38179769, 38226611
Pseudolymphoma	Associate	18384222
Squamous Cell Carcinoma of Head and Neck	Associate	33315534, 33892811
Stomach Neoplasms	Stimulate	27314162
Stomach Neoplasms	Associate	28069036, 36304254
Thyroid cancer medullary	Associate	24488334
Triple Negative Breast Neoplasms	Associate	32766313
Urinary Bladder Neoplasms	Associate	23873098, 36304254
Uterine Cervical Dysplasia	Associate	26624896
Uterine Cervical Neoplasms	Associate	33728810

TPX2 (TPX2 microtubule nucleation factor)