Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22974
Gene name Gene Name - the full gene name approved by the HGNC.
TPX2 microtubule nucleation factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TPX2
Synonyms (NCBI Gene) Gene synonyms aliases
C20orf1, C20orf2, DIL-2, DIL2, FLS353, GD:C20orf1, HCA519, HCTP4, REPP86, p100
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.21
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT041448 hsa-miR-193b-3p CLASH 23622248
MIRT733798 hsa-miR-338-3p Microarray, qRT-PCR 33789319
MIRT736547 hsa-miR-548a-3p Luciferase reporter assay, Western blotting, qRT-PCR 32857606
MIRT737338 hsa-miR-216b-3p Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry 32169806
MIRT755887 hsa-miR-29c-3p Luciferase reporter assay, Western blotting, qRT-PCR 35340555
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle TAS 9207457
GO:0000922 Component Spindle pole IDA 14718566
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 14580337, 17474147, 19357306, 20360068, 21242313, 22110403, 25416956, 25986610, 27837025, 28514442, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605917 1249 ENSG00000088325
Protein
UniProt ID Q9ULW0
Protein name Targeting protein for Xklp2 (Differentially expressed in cancerous and non-cancerous lung cells 2) (DIL-2) (Hepatocellular carcinoma-associated antigen 519) (Hepatocellular carcinoma-associated antigen 90) (Protein fls353) (Restricted expression prolifera
Protein function Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to s
PDB 1OL5 , 3E5A , 3HA6 , 4C3P , 5LXM , 6BJC , 6VPG , 6VPH , 6VPI , 6VPJ , 6VPL , 6VPM , 6XKA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09041 Aurora-A_bind 1 68 Aurora-A binding Disordered
PF12214 TPX2_importin 361 489 Cell cycle regulated microtubule associated protein Family
PF06886 TPX2 540 592 Targeting protein for Xklp2 (TPX2) domain Domain
PF06886 TPX2 660 740 Targeting protein for Xklp2 (TPX2) domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung carcinoma cell lines but not in normal lung tissues.
Sequence
MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTP
LRKANLQQ
AIVTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRR
SLRLSAQKDLEQKEKHHVKMKAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTA
EKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEVVEMRKKNEEFKKLAL
AGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKG
CTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDDINLLPSKSSV
TKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLP
ITVPKSPAF
ALKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSF
DSRDKERQLQKEKKIKELQKGEVPKFKALPLPHFDTINLPEKKVKNVTQIEP
FCLETDRR
GALKAQTWKHQLEEELRQQKEAACFKARPNTVISQEPFVPKKEKKSVAEGLSGSLVQEPF
QLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQKKEELARLRRELVHKANPIRK
YQGLEIKSSDQPLTVPVSPK
FSTRFHC
Sequence length 747
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of TP53 Activity through Phosphorylation
AURKA Activation by TPX2
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension (confirmatory factor analysis Factor 12) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23357462, 30588191, 33029085, 33126397, 34734491, 36304254, 37768502, 38266813
Breast Neoplasms Associate 23468873, 25830658, 29138345, 31285741, 31799669, 33499770, 33622270, 34384030, 36930083, 38643462
Carcinogenesis Associate 25632068, 33029085
Carcinoma Hepatocellular Stimulate 12097419
Carcinoma Hepatocellular Associate 32722976, 33102593, 34257537, 36120772, 36204642, 36304254, 36707511
Carcinoma Non Small Cell Lung Associate 15983384, 28101582, 31775549, 31816603, 32748897, 36202977
Carcinoma Ovarian Epithelial Associate 24625450
Carcinoma Pancreatic Ductal Associate 15983384, 29483831, 37142730
Carcinoma Renal Cell Associate 28260099, 32309427, 32626756, 33154194, 34606125, 35896362
Carcinoma Renal Cell Stimulate 40362354