Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22954
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 32
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM32
Synonyms (NCBI Gene) Gene synonyms aliases	BBS11, HT2A, LGMD2H, LGMDR8, TATIP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BBS11, LGMDR8
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The p

Show/Hide all(237)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001492	hsa-miR-155-5p	pSILAC	18668040
MIRT001492	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT031385	hsa-miR-16-5p	Proteomics	18668040
MIRT001492	hsa-miR-155-5p	Microarray, qRT-PCR	25128227
MIRT001492	hsa-miR-155-5p	Microarray, qRT-PCR	25128227
MIRT227329	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT001492	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT227326	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT227329	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT001492	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT227325	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT227331	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT227327	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT227333	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT227326	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT001492	hsa-miR-155-5p	ChIP-seq, Luciferase reporter assay, Western blot	26497687
MIRT227326	hsa-miR-20a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32319789
MIRT1453805	hsa-miR-1224-5p	CLIP-seq
MIRT1453806	hsa-miR-3915	CLIP-seq
MIRT1453807	hsa-miR-3928	CLIP-seq
MIRT1453808	hsa-miR-4426	CLIP-seq
MIRT1453809	hsa-miR-4534	CLIP-seq
MIRT1453810	hsa-miR-4647	CLIP-seq
MIRT1453811	hsa-miR-4662b	CLIP-seq
MIRT1453812	hsa-miR-4689	CLIP-seq
MIRT1453813	hsa-miR-495	CLIP-seq
MIRT1453814	hsa-miR-548ac	CLIP-seq
MIRT1453815	hsa-miR-548ae	CLIP-seq
MIRT1453816	hsa-miR-548aj	CLIP-seq
MIRT1453817	hsa-miR-548am	CLIP-seq
MIRT1453818	hsa-miR-548d-3p	CLIP-seq
MIRT1453819	hsa-miR-548x	CLIP-seq
MIRT1453820	hsa-miR-548z	CLIP-seq
MIRT1453821	hsa-miR-570	CLIP-seq
MIRT1453822	hsa-miR-1273e	CLIP-seq
MIRT1453823	hsa-miR-3123	CLIP-seq
MIRT1453824	hsa-miR-3688-3p	CLIP-seq
MIRT1453825	hsa-miR-3925-5p	CLIP-seq
MIRT1453826	hsa-miR-3976	CLIP-seq
MIRT1453827	hsa-miR-3978	CLIP-seq
MIRT1453828	hsa-miR-4490	CLIP-seq
MIRT1453829	hsa-miR-4694-3p	CLIP-seq
MIRT1453830	hsa-miR-485-3p	CLIP-seq
MIRT1453831	hsa-miR-539	CLIP-seq
MIRT1453832	hsa-miR-548u	CLIP-seq
MIRT2136099	hsa-miR-1245b-3p	CLIP-seq
MIRT2136100	hsa-miR-1252	CLIP-seq
MIRT2136101	hsa-miR-4261	CLIP-seq
MIRT2136102	hsa-miR-4420	CLIP-seq
MIRT2136103	hsa-miR-4468	CLIP-seq
MIRT2136104	hsa-miR-4476	CLIP-seq
MIRT2136105	hsa-miR-4496	CLIP-seq
MIRT2136106	hsa-miR-4528	CLIP-seq
MIRT2136107	hsa-miR-4533	CLIP-seq
MIRT2136108	hsa-miR-4766-5p	CLIP-seq
MIRT2136109	hsa-miR-488	CLIP-seq
MIRT2136110	hsa-miR-668	CLIP-seq
MIRT2357087	hsa-miR-3591-3p	CLIP-seq
MIRT2136102	hsa-miR-4420	CLIP-seq
MIRT2136103	hsa-miR-4468	CLIP-seq
MIRT2136108	hsa-miR-4766-5p	CLIP-seq
MIRT2136109	hsa-miR-488	CLIP-seq
MIRT2136110	hsa-miR-668	CLIP-seq
MIRT2136106	hsa-miR-4528	CLIP-seq
MIRT2136108	hsa-miR-4766-5p	CLIP-seq
MIRT1453805	hsa-miR-1224-5p	CLIP-seq
MIRT2136099	hsa-miR-1245b-3p	CLIP-seq
MIRT2136100	hsa-miR-1252	CLIP-seq
MIRT2650673	hsa-miR-1272	CLIP-seq
MIRT2650674	hsa-miR-128	CLIP-seq
MIRT2650675	hsa-miR-1322	CLIP-seq
MIRT2650676	hsa-miR-148a	CLIP-seq
MIRT2650677	hsa-miR-148b	CLIP-seq
MIRT2650678	hsa-miR-152	CLIP-seq
MIRT2650679	hsa-miR-183	CLIP-seq
MIRT2650680	hsa-miR-2115	CLIP-seq
MIRT2650681	hsa-miR-2276	CLIP-seq
MIRT2650682	hsa-miR-2964a-5p	CLIP-seq
MIRT2650683	hsa-miR-3156-3p	CLIP-seq
MIRT2650684	hsa-miR-3158-3p	CLIP-seq
MIRT2650685	hsa-miR-320a	CLIP-seq
MIRT2650686	hsa-miR-320b	CLIP-seq
MIRT2650687	hsa-miR-320c	CLIP-seq
MIRT2650688	hsa-miR-320d	CLIP-seq
MIRT2650689	hsa-miR-335	CLIP-seq
MIRT2650690	hsa-miR-34a	CLIP-seq
MIRT2650691	hsa-miR-34c-5p	CLIP-seq
MIRT2357087	hsa-miR-3591-3p	CLIP-seq
MIRT2650692	hsa-miR-3647-3p	CLIP-seq
MIRT2650693	hsa-miR-3657	CLIP-seq
MIRT1453806	hsa-miR-3915	CLIP-seq
MIRT1453807	hsa-miR-3928	CLIP-seq
MIRT2650694	hsa-miR-409-3p	CLIP-seq
MIRT2650695	hsa-miR-4301	CLIP-seq
MIRT2136102	hsa-miR-4420	CLIP-seq
MIRT1453808	hsa-miR-4426	CLIP-seq
MIRT2650696	hsa-miR-4429	CLIP-seq
MIRT2650697	hsa-miR-4436b-5p	CLIP-seq
MIRT2136103	hsa-miR-4468	CLIP-seq
MIRT2136104	hsa-miR-4476	CLIP-seq
MIRT2136105	hsa-miR-4496	CLIP-seq
MIRT2650698	hsa-miR-449a	CLIP-seq
MIRT2650699	hsa-miR-449b	CLIP-seq
MIRT2650700	hsa-miR-4509	CLIP-seq
MIRT2650701	hsa-miR-4517	CLIP-seq
MIRT2136106	hsa-miR-4528	CLIP-seq
MIRT2136107	hsa-miR-4533	CLIP-seq
MIRT1453809	hsa-miR-4534	CLIP-seq
MIRT2650702	hsa-miR-4633-3p	CLIP-seq
MIRT2650703	hsa-miR-4645-5p	CLIP-seq
MIRT1453810	hsa-miR-4647	CLIP-seq
MIRT1453811	hsa-miR-4662b	CLIP-seq
MIRT2650704	hsa-miR-4669	CLIP-seq
MIRT2650705	hsa-miR-4673	CLIP-seq
MIRT2650706	hsa-miR-4681	CLIP-seq
MIRT1453812	hsa-miR-4689	CLIP-seq
MIRT2650707	hsa-miR-4691-5p	CLIP-seq
MIRT2650708	hsa-miR-4706	CLIP-seq
MIRT2650709	hsa-miR-4716-3p	CLIP-seq
MIRT2650710	hsa-miR-4728-5p	CLIP-seq
MIRT2650711	hsa-miR-4747-5p	CLIP-seq
MIRT2650712	hsa-miR-4749-5p	CLIP-seq
MIRT2136108	hsa-miR-4766-5p	CLIP-seq
MIRT2650713	hsa-miR-4772-3p	CLIP-seq
MIRT2650714	hsa-miR-4781-5p	CLIP-seq
MIRT2650715	hsa-miR-4799-5p	CLIP-seq
MIRT2136109	hsa-miR-488	CLIP-seq
MIRT1453813	hsa-miR-495	CLIP-seq
MIRT2650716	hsa-miR-513a-3p	CLIP-seq
MIRT2650717	hsa-miR-513c	CLIP-seq
MIRT2650718	hsa-miR-514b-5p	CLIP-seq
MIRT2650719	hsa-miR-516a-3p	CLIP-seq
MIRT1453814	hsa-miR-548ac	CLIP-seq
MIRT1453815	hsa-miR-548ae	CLIP-seq
MIRT1453816	hsa-miR-548aj	CLIP-seq
MIRT1453817	hsa-miR-548am	CLIP-seq
MIRT1453818	hsa-miR-548d-3p	CLIP-seq
MIRT1453819	hsa-miR-548x	CLIP-seq
MIRT1453820	hsa-miR-548z	CLIP-seq
MIRT1453821	hsa-miR-570	CLIP-seq
MIRT2650720	hsa-miR-597	CLIP-seq
MIRT2136110	hsa-miR-668	CLIP-seq
MIRT2650721	hsa-miR-676	CLIP-seq
MIRT2650722	hsa-miR-759	CLIP-seq
MIRT1453805	hsa-miR-1224-5p	CLIP-seq
MIRT2136099	hsa-miR-1245b-3p	CLIP-seq
MIRT2136100	hsa-miR-1252	CLIP-seq
MIRT2650673	hsa-miR-1272	CLIP-seq
MIRT2650674	hsa-miR-128	CLIP-seq
MIRT2694155	hsa-miR-1291	CLIP-seq
MIRT2650675	hsa-miR-1322	CLIP-seq
MIRT2650676	hsa-miR-148a	CLIP-seq
MIRT2650677	hsa-miR-148b	CLIP-seq
MIRT2650678	hsa-miR-152	CLIP-seq
MIRT2650679	hsa-miR-183	CLIP-seq
MIRT2650680	hsa-miR-2115	CLIP-seq
MIRT2650681	hsa-miR-2276	CLIP-seq
MIRT2650682	hsa-miR-2964a-5p	CLIP-seq
MIRT2694156	hsa-miR-3127-3p	CLIP-seq
MIRT2650683	hsa-miR-3156-3p	CLIP-seq
MIRT2650684	hsa-miR-3158-3p	CLIP-seq
MIRT2694157	hsa-miR-3176	CLIP-seq
MIRT2650685	hsa-miR-320a	CLIP-seq
MIRT2650686	hsa-miR-320b	CLIP-seq
MIRT2650687	hsa-miR-320c	CLIP-seq
MIRT2650688	hsa-miR-320d	CLIP-seq
MIRT2694158	hsa-miR-328	CLIP-seq
MIRT2694159	hsa-miR-330-3p	CLIP-seq
MIRT2650689	hsa-miR-335	CLIP-seq
MIRT2650690	hsa-miR-34a	CLIP-seq
MIRT2650691	hsa-miR-34c-5p	CLIP-seq
MIRT2357087	hsa-miR-3591-3p	CLIP-seq
MIRT2694160	hsa-miR-3613-5p	CLIP-seq
MIRT2650692	hsa-miR-3647-3p	CLIP-seq
MIRT2650693	hsa-miR-3657	CLIP-seq
MIRT2694161	hsa-miR-3713	CLIP-seq
MIRT1453806	hsa-miR-3915	CLIP-seq
MIRT2694162	hsa-miR-3922-3p	CLIP-seq
MIRT1453807	hsa-miR-3928	CLIP-seq
MIRT2650694	hsa-miR-409-3p	CLIP-seq
MIRT2136101	hsa-miR-4261	CLIP-seq
MIRT2650695	hsa-miR-4301	CLIP-seq
MIRT2136102	hsa-miR-4420	CLIP-seq
MIRT1453808	hsa-miR-4426	CLIP-seq
MIRT2650696	hsa-miR-4429	CLIP-seq
MIRT2650697	hsa-miR-4436b-5p	CLIP-seq
MIRT2136103	hsa-miR-4468	CLIP-seq
MIRT2136104	hsa-miR-4476	CLIP-seq
MIRT2136105	hsa-miR-4496	CLIP-seq
MIRT2650698	hsa-miR-449a	CLIP-seq
MIRT2650699	hsa-miR-449b	CLIP-seq
MIRT2650700	hsa-miR-4509	CLIP-seq
MIRT2650701	hsa-miR-4517	CLIP-seq
MIRT2136106	hsa-miR-4528	CLIP-seq
MIRT2136107	hsa-miR-4533	CLIP-seq
MIRT1453809	hsa-miR-4534	CLIP-seq
MIRT2650702	hsa-miR-4633-3p	CLIP-seq
MIRT2650703	hsa-miR-4645-5p	CLIP-seq
MIRT1453810	hsa-miR-4647	CLIP-seq
MIRT1453811	hsa-miR-4662b	CLIP-seq
MIRT2650704	hsa-miR-4669	CLIP-seq
MIRT2694163	hsa-miR-4670-3p	CLIP-seq
MIRT2650705	hsa-miR-4673	CLIP-seq
MIRT2650706	hsa-miR-4681	CLIP-seq
MIRT1453812	hsa-miR-4689	CLIP-seq
MIRT2650707	hsa-miR-4691-5p	CLIP-seq
MIRT2650708	hsa-miR-4706	CLIP-seq
MIRT2650709	hsa-miR-4716-3p	CLIP-seq
MIRT2650710	hsa-miR-4728-5p	CLIP-seq
MIRT2650711	hsa-miR-4747-5p	CLIP-seq
MIRT2650712	hsa-miR-4749-5p	CLIP-seq
MIRT2694164	hsa-miR-4761-3p	CLIP-seq
MIRT2136108	hsa-miR-4766-5p	CLIP-seq
MIRT2650713	hsa-miR-4772-3p	CLIP-seq
MIRT2694165	hsa-miR-4781-3p	CLIP-seq
MIRT2650714	hsa-miR-4781-5p	CLIP-seq
MIRT2650715	hsa-miR-4799-5p	CLIP-seq
MIRT2136109	hsa-miR-488	CLIP-seq
MIRT1453813	hsa-miR-495	CLIP-seq
MIRT2650716	hsa-miR-513a-3p	CLIP-seq
MIRT2650717	hsa-miR-513c	CLIP-seq
MIRT2650718	hsa-miR-514b-5p	CLIP-seq
MIRT2650719	hsa-miR-516a-3p	CLIP-seq
MIRT1453814	hsa-miR-548ac	CLIP-seq
MIRT1453815	hsa-miR-548ae	CLIP-seq
MIRT1453816	hsa-miR-548aj	CLIP-seq
MIRT1453817	hsa-miR-548am	CLIP-seq
MIRT1453818	hsa-miR-548d-3p	CLIP-seq
MIRT1453819	hsa-miR-548x	CLIP-seq
MIRT1453820	hsa-miR-548z	CLIP-seq
MIRT1453821	hsa-miR-570	CLIP-seq
MIRT2694166	hsa-miR-581	CLIP-seq
MIRT2650720	hsa-miR-597	CLIP-seq
MIRT2136110	hsa-miR-668	CLIP-seq
MIRT2650721	hsa-miR-676	CLIP-seq
MIRT2650722	hsa-miR-759	CLIP-seq
MIRT2694167	hsa-miR-9	CLIP-seq

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	18632609
GO:0001894	Process	Tissue homeostasis	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0003723	Function	RNA binding	ISS
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19349376
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 16816390, 18632609, 19060904, 19349376, 19549727, 19690564, 21516116, 21903422, 22493164, 25416956, 25910212, 26871637, 27173435, 28514442, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19349376
GO:0005829	Component	Cytosol	TAS
GO:0005863	Component	Striated muscle myosin thick filament	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	19349376
GO:0007014	Process	Actin ubiquitination	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009411	Process	Response to UV	ISS
GO:0016567	Process	Protein ubiquitination	IDA	16816390
GO:0017022	Function	Myosin binding	ISS
GO:0030307	Process	Positive regulation of cell growth	IDA	18632609
GO:0030335	Process	Positive regulation of cell migration	IDA	18632609
GO:0030957	Function	Tat protein binding	TAS	16175175
GO:0031369	Function	Translation initiation factor binding	ISS
GO:0032479	Process	Regulation of type I interferon production	TAS
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0034612	Process	Response to tumor necrosis factor	ISS
GO:0042802	Function	Identical protein binding	IPI	22493164, 25416956, 32296183
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	23077300
GO:0043130	Function	Ubiquitin binding	IDA	19349376
GO:0043621	Function	Protein self-association	IDA	19349376
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045087	Process	Innate immune response	TAS	16175175
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045732	Process	Positive regulation of protein catabolic process	ISS
GO:0045787	Process	Positive regulation of cell cycle	IDA	18632609
GO:0045862	Process	Positive regulation of proteolysis	IDA	18632609
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	ISS
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	23077300
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	23077300
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0051155	Process	Positive regulation of striated muscle cell differentiation	IEA
GO:0061564	Process	Axon development	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	16816390
GO:0070936	Process	Protein K48-linked ubiquitination	IBA	21873635
GO:1902187	Process	Negative regulation of viral release from host cell	IDA	18248090
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IDA	18632609
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:1903883	Process	Positive regulation of interleukin-17-mediated signaling pathway	IEA
GO:1903886	Process	Positive regulation of chemokine (C-C motif) ligand 20 production	IEA
GO:2000147	Process	Positive regulation of cell motility	ISS

MIM	HGNC	e!Ensembl
602290	16380	ENSG00000119401

Protein

UniProt ID

Q13049

Protein name

E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A)

Protein function

E3 ubiquitin ligase that plays a role in various biological processes including neural stem cell differentiation, innate immunity, inflammatory resonse and autophagy (PubMed:19349376, PubMed:31123703). Plays a role in virus-triggered induction o

PDB

2CT2 , 5FEY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13445	zf-RING_UBOX	20 → 62	RING-type zinc-finger	Domain
PF01436	NHL	371 → 398	NHL repeat	Repeat
PF01436	NHL	469 → 496	NHL repeat	Repeat
PF01436	NHL	616 → 643	NHL repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Spleen, thymus, prostate, testis, ovary, intestine, colon and skeletal muscle. {ECO:0000269|PubMed:11822024}.

Sequence

MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLC
EPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQAR
YKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSRCD
YFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
VNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAASNIQQCLFLKK
MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPS
GQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENR
QNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP

Sequence length

653

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Regulation of innate immune responses to cytosolic DNA Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (13)

Disease term	Disease name	dbSNP ID	References
Causal
Bardet-biedl syndrome	Bardet-Biedl Syndrome, BARDET-BIEDL SYNDROME 11, Bardet-Biedl syndrome 1 (disorder), Bardet-Biedl syndrome	rs397704728, rs397515335, rs397515337, rs267607031, rs121918327, rs587777801, rs587777802, rs121918328, rs587777803, rs549625604, rs137852837, rs137852833, rs137852835, rs267606719, rs199874059 View all (560 more)	21775502, 15786463, 11822024, 23142638, 16606853, 17994549
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Hypertension	Hypertensive disease	rs13306026
Limb-girdle muscular dystrophy	Muscular Dystrophies, Limb-Girdle	rs2137534216, rs104894422, rs762777463, rs104894423, rs137854524, rs137854521, rs137854523, rs137854529, rs398123555, rs119463996, rs587777814, rs119463992, rs267606971, rs267606967, rs28941782 View all (762 more)
Sarcotubular myopathy	TRIM32-related limb-girdle muscular dystrophy R8, Limb-girdle muscular dystrophy type 2H	rs111033570, rs1588218453, rs747266069	17994549, 11822024, 15786463, 30823891, 21775502, 16606853
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Muscular dystrophy	Muscular Dystrophy	rs200198778, rs121908110, rs121908185, rs58932704, rs61672878, rs60458016, rs387906881, rs397509417, rs267607644, rs267607634, rs59332535, rs797045898, rs755660222, rs142908436, rs886039913 View all (15 more)
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910 View all (152 more)
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)
Polydactyly	Polydactyly	rs1583729398, rs121917709, rs1583734240, rs121917714, rs397507422, rs398122899, rs587776959, rs386833752, rs1057518698, rs1060499558, rs755938967, rs1375768446, rs1309855392, rs1565601979, rs748321474 View all (3 more)	16606853
Retinitis pigmentosa	Retinitis Pigmentosa	rs267606794, rs200691042, rs397704718, rs202193201, rs267606793, rs2147483647, rs779886453, rs267606691, rs794728002, rs878853253, rs137853189, rs137853190, rs137853112, rs137853113, rs137853114 View all (1830 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Bardet-Biedl Syndrome	Bardet-Biedl syndrome 11			GenCC

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic Lateral Sclerosis	Associate	23469062
Arthritis Rheumatoid	Associate	32145086
Atrophy	Associate	31234693
Attention Deficit Disorder with Hyperactivity	Associate	24381304
Autism Spectrum Disorder	Associate	24381304
Bardet Biedl Syndrome	Associate	20177705, 23404957, 25351777, 30823891
Carcinogenesis	Associate	21628460
Carcinoma Renal Cell	Associate	33173411
Cognition Disorders	Associate	25351777
Developmental Disabilities	Associate	24381304
Facioscapulohumeral Muscular Dystrophy 1B	Associate	32419263
Hereditary renal agenesis	Associate	34311961
Inclusion Body Myopathy 3 Autosomal Dominant	Associate	31309175
Inflammation	Stimulate	32145086
Leukemia Myeloid Acute	Associate	36102723
Limb girdle muscular dystrophy type 2H	Associate	25351777, 30823891, 31309175
Lymphoma Non Hodgkin	Associate	21628460, 31309175
Malformations of Cortical Development Group I	Associate	38317520
Mental Disorders	Associate	34267256
Multiple System Atrophy	Associate	30823891
Muscle Weakness	Associate	30823891
Muscular Atrophy	Associate	23469062
Muscular Diseases	Associate	30823891
Muscular Disorders Atrophic	Associate	31234693
Muscular Dystrophies	Associate	19835634, 21628460, 30823891, 31234693, 33999923
Muscular Dystrophies Limb Girdle	Associate	31234693, 33386810, 37217920, 40038764
Muscular Dystrophy Limb Girdle Type 2I	Associate	32419263
Myofibrillar Myopathy	Associate	31309175
Neoplasms	Inhibit	21628460
Neoplasms	Associate	30079558, 33999923
Nerve Degeneration	Associate	38317520
Obsessive Compulsive Disorder	Associate	24381304
Osteoarthritis	Associate	32145086
Parkinson Disease	Associate	38317520
Psychotic Disorders	Associate	34267256
Pulmonary Disease Chronic Obstructive	Associate	29648516, 35308900
Pulmonary Fibrosis	Associate	30756084
Stomach Neoplasms	Associate	30079558
Vacuolar myopathy	Associate	32419263
Werner Syndrome	Associate	34311961

TRIM32 (tripartite motif containing 32)