Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2295
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box F2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXF2
Synonyms (NCBI Gene) Gene synonyms aliases
FKHL6, FREAC-2, FREAC2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p25.3
Summary Summary of gene provided in NCBI Entrez Gene.
FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by R
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007330 hsa-miR-182-5p Luciferase reporter assay 23383207
MIRT022115 hsa-miR-124-3p Microarray 18668037
MIRT028797 hsa-miR-26b-5p Microarray 19088304
MIRT612027 hsa-miR-8485 HITS-CLIP 23824327
MIRT612026 hsa-miR-346 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 8626802
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603250 3810 ENSG00000137273
Protein
UniProt ID Q12947
Protein name Forkhead box protein F2 (Forkhead-related activator 2) (FREAC-2) (Forkhead-related protein FKHL6) (Forkhead-related transcription factor 2)
Protein function Probable transcription activator for a number of lung-specific genes (PubMed:8626802). Mediates up-regulation of the E3 ligase IRF2BPL and drives ubiquitination and degradation of CTNNB1 (PubMed:29374064). {ECO:0000269|PubMed:29374064, ECO:00002
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 99 185 Forkhead domain Domain
Tissue specificity TISSUE SPECIFICITY: Lung and placenta (PubMed:8626802). Predominantly expressed in gastrointestinal tract including stomach (PubMed:29374064). {ECO:0000269|PubMed:29374064, ECO:0000269|PubMed:8626802}.
Sequence
MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSS
SSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKR
LTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPAS
EFMFE
EGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQ
GGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAA
GGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSN
PAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFH
PSASGSYYHHHHQSVCQDIKPCVM
Sequence length 444
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Erectile Dysfunction Erectile Dysfunction GWAS
Astrocytoma Astrocytoma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Agranulocytosis Associate 27157822
Ascending aortic aneurysm hypertelorism bifid uvula cleft palate and arterial tortuosity Associate 30917284
Breast Neoplasms Associate 23620774, 26070560, 28829888, 35660418
Breast Neoplasms Inhibit 26210254
Bronchopulmonary Dysplasia Associate 30459472
Carcinoma Non Small Cell Lung Associate 27487137
Carcinoma Non Small Cell Lung Stimulate 31858547
Cleft Palate Associate 19276632, 30917284
Colorectal Neoplasms Associate 28849155, 30987631, 32103872
Developmental Disabilities Associate 19276632