PTGR1 (prostaglandin reductase 1)

Gene

• Entrez ID: 22949
• Gene name: Prostaglandin reductase 1
• Gene symbol: PTGR1
• Synonyms (NCBI Gene): DIG-1, LTB4DH, PGR1, ZADH3
• Chromosome: 9
• Chromosome location: 9q31.3
• Summary: This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1273256	hsa-miR-1911	CLIP-seq
MIRT1273257	hsa-miR-208a	CLIP-seq
MIRT1273258	hsa-miR-208b	CLIP-seq
MIRT1273259	hsa-miR-3617	CLIP-seq
MIRT1273260	hsa-miR-4528	CLIP-seq
MIRT1273261	hsa-miR-499-5p	CLIP-seq
MIRT1273262	hsa-miR-641	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	NAS	8576264
GO:0006693	Process	Prostaglandin metabolic process	IBA
GO:0006693	Process	Prostaglandin metabolic process	IDA	25619643
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016628	Function	Oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor	IEA
GO:0032440	Function	2-alkenal reductase [NAD(P)H] activity	IEA
GO:0035798	Function	2-alkenal reductase (NADPH) activity	IDA	25619643
GO:0035798	Function	2-alkenal reductase (NADPH) activity	IEA
GO:0036102	Process	Leukotriene B4 metabolic process	ISS
GO:0036185	Function	13-lipoxin reductase activity	ISS
GO:0047522	Function	15-oxoprostaglandin 13-reductase [NAD(P)+] activity	IBA
GO:0047522	Function	15-oxoprostaglandin 13-reductase [NAD(P)+] activity	IDA	25619643
GO:0047522	Function	15-oxoprostaglandin 13-reductase [NAD(P)+] activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097257	Function	Leukotriene B4 12-hydroxy dehydrogenase activity	IEA
GO:0097257	Function	Leukotriene B4 12-hydroxy dehydrogenase activity	ISS
GO:2001302	Process	Lipoxin A4 metabolic process	ISS

Other IDs

• MIM: 601274
• HGNC: 18429
• e!Ensembl: ENSG00000106853

Protein

• UniProt ID: Q14914
• Protein name: Prostaglandin reductase 1 (PRG-1) (15-oxoprostaglandin 13-reductase) (EC 1.3.1.48) (Dithiolethione-inducible gene 1 protein) (D3T-inducible gene 1 protein) (DIG-1) (Leukotriene B4 12-hydroxydehydrogenase) (NAD(P)H-dependent alkenal/one oxidoreductase) (EC
• Protein function: NAD(P)H-dependent oxidoreductase involved in metabolic inactivation of pro- and anti-inflammatory eicosanoids: prostaglandins (PG), leukotrienes (LT) and lipoxins (LX) (PubMed:25619643). Catalyzes with high efficiency the reduction of the 13,14
• PDB: 1ZSV, 2Y05
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16884	ADH_N_2	5 → 105	N-terminal domain of oxidoreductase	Family
  PF00107	ADH_zinc_N	153 → 293	Zinc-binding dehydrogenase	Family

• Tissue specificity: TISSUE SPECIFICITY: High expression in the kidney, liver, and intestine but not in leukocytes. {ECO:0000269|PubMed:8576264}.
• Sequence:

  MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEG
  DTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALG
  TVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVA
  YLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICG
  AISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE
  YIIEGFENMPAAFMGMLKGDNLGKTIVKA

• Sequence length: 329

Pathways

KEGG:

Arachidonic acid metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Calcinosis Cutis	Associate	30630697	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	27429979	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30630697	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	37996508	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	34504628	★☆☆☆☆ Found in Text Mining only
Clear cell metastatic renal cell carcinoma	Associate	39523403	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	31724326	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	27116978	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	34634267	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	38112943	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	27429979	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	28117410	★☆☆☆☆ Found in Text Mining only
Margins of Excision	Associate	37996508	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	30630697	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	27429979, 29471829, 34634267, 39523403, 39965292	★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Associate	38112943	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	27150108, 37582751	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	38256104	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26823768	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	29471829	★☆☆☆☆ Found in Text Mining only
Urethral Neoplasms	Associate	39523403	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	25907251	★☆☆☆☆ Found in Text Mining only