Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22943
Gene name Gene Name - the full gene name approved by the HGNC.	Dickkopf Wnt signaling pathway inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DKK1
Synonyms (NCBI Gene) Gene synonyms aliases	DKK-1, SK
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibit

Show/Hide all(355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003609	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20551325
MIRT005874	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005874	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005874	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005874	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005874	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT023613	hsa-miR-1-3p	Microarray	18668037
MIRT052959	hsa-miR-371a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22020335
MIRT053299	hsa-miR-372-3p	Luciferase reporter assay, qRT-PCR, Western blot	22020335
MIRT053300	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	22020335
MIRT732132	hsa-miR-493-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26799283
MIRT732132	hsa-miR-493-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26799283
MIRT732132	hsa-miR-493-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26799283
MIRT732132	hsa-miR-493-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26799283
MIRT053300	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	28337453
MIRT053300	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	28337453
MIRT736120	hsa-miR-335-5p	qRT-PCR, Western blot	26986081
MIRT733475	hsa-miR-106a-5p	qRT-PCR	34184078
MIRT733476	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT735711	hsa-miR-107	Luciferase reporter assay, Western blotting, qRT-PCR	34234100
MIRT736120	hsa-miR-335-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31679313
MIRT735711	hsa-miR-107	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	34234100
MIRT756012	hsa-miR-5584-3p	Luciferase reporter assay, Western blotting, qRT-PCR, RNA-seq	38883346
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937544	hsa-miR-103a	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937547	hsa-miR-1261	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT937550	hsa-miR-148a	CLIP-seq
MIRT937551	hsa-miR-148b	CLIP-seq
MIRT937552	hsa-miR-152	CLIP-seq
MIRT937553	hsa-miR-186	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937558	hsa-miR-2682	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937565	hsa-miR-3065-3p	CLIP-seq
MIRT937566	hsa-miR-3125	CLIP-seq
MIRT937567	hsa-miR-3133	CLIP-seq
MIRT937568	hsa-miR-3140-3p	CLIP-seq
MIRT937569	hsa-miR-3148	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937571	hsa-miR-3163	CLIP-seq
MIRT937572	hsa-miR-320e	CLIP-seq
MIRT937573	hsa-miR-329	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937576	hsa-miR-33a	CLIP-seq
MIRT937577	hsa-miR-33b	CLIP-seq
MIRT937578	hsa-miR-34a	CLIP-seq
MIRT937579	hsa-miR-34c-5p	CLIP-seq
MIRT937580	hsa-miR-3613-3p	CLIP-seq
MIRT937581	hsa-miR-362-3p	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937583	hsa-miR-3653	CLIP-seq
MIRT937584	hsa-miR-3658	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937590	hsa-miR-3916	CLIP-seq
MIRT937591	hsa-miR-3921	CLIP-seq
MIRT937592	hsa-miR-3941	CLIP-seq
MIRT937593	hsa-miR-3942-3p	CLIP-seq
MIRT937594	hsa-miR-3944-5p	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT937601	hsa-miR-4317	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937603	hsa-miR-4420	CLIP-seq
MIRT937604	hsa-miR-449a	CLIP-seq
MIRT937605	hsa-miR-449b	CLIP-seq
MIRT937606	hsa-miR-449c	CLIP-seq
MIRT937607	hsa-miR-4503	CLIP-seq
MIRT937608	hsa-miR-4509	CLIP-seq
MIRT937609	hsa-miR-4511	CLIP-seq
MIRT937610	hsa-miR-4653-5p	CLIP-seq
MIRT937611	hsa-miR-4662a-3p	CLIP-seq
MIRT937612	hsa-miR-4694-3p	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT937616	hsa-miR-4768-5p	CLIP-seq
MIRT937617	hsa-miR-4773	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937619	hsa-miR-4789-3p	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937626	hsa-miR-511	CLIP-seq
MIRT937627	hsa-miR-513a-3p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937641	hsa-miR-522	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT937643	hsa-miR-548ae	CLIP-seq
MIRT937644	hsa-miR-548aj	CLIP-seq
MIRT937645	hsa-miR-548am	CLIP-seq
MIRT937646	hsa-miR-548b-3p	CLIP-seq
MIRT937647	hsa-miR-548n	CLIP-seq
MIRT937648	hsa-miR-548t	CLIP-seq
MIRT937649	hsa-miR-548x	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT937651	hsa-miR-561	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT937656	hsa-miR-587	CLIP-seq
MIRT937657	hsa-miR-590-3p	CLIP-seq
MIRT937658	hsa-miR-603	CLIP-seq
MIRT937659	hsa-miR-607	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT937663	hsa-miR-940	CLIP-seq
MIRT1977534	hsa-miR-1	CLIP-seq
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937544	hsa-miR-103a	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937547	hsa-miR-1261	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT1977535	hsa-miR-1468	CLIP-seq
MIRT937550	hsa-miR-148a	CLIP-seq
MIRT937551	hsa-miR-148b	CLIP-seq
MIRT937552	hsa-miR-152	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT1977536	hsa-miR-206	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937558	hsa-miR-2682	CLIP-seq
MIRT1977537	hsa-miR-297	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937565	hsa-miR-3065-3p	CLIP-seq
MIRT937566	hsa-miR-3125	CLIP-seq
MIRT937568	hsa-miR-3140-3p	CLIP-seq
MIRT1977538	hsa-miR-3143	CLIP-seq
MIRT1977539	hsa-miR-3145-3p	CLIP-seq
MIRT937569	hsa-miR-3148	CLIP-seq
MIRT1977540	hsa-miR-3156-5p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937571	hsa-miR-3163	CLIP-seq
MIRT1977541	hsa-miR-3202	CLIP-seq
MIRT937572	hsa-miR-320e	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937578	hsa-miR-34a	CLIP-seq
MIRT937579	hsa-miR-34c-5p	CLIP-seq
MIRT1977542	hsa-miR-3618	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937583	hsa-miR-3653	CLIP-seq
MIRT937584	hsa-miR-3658	CLIP-seq
MIRT1977543	hsa-miR-3673	CLIP-seq
MIRT1977544	hsa-miR-3674	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937590	hsa-miR-3916	CLIP-seq
MIRT937593	hsa-miR-3942-3p	CLIP-seq
MIRT937594	hsa-miR-3944-5p	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT1977545	hsa-miR-433	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937603	hsa-miR-4420	CLIP-seq
MIRT937604	hsa-miR-449a	CLIP-seq
MIRT937605	hsa-miR-449b	CLIP-seq
MIRT937606	hsa-miR-449c	CLIP-seq
MIRT937607	hsa-miR-4503	CLIP-seq
MIRT937608	hsa-miR-4509	CLIP-seq
MIRT937609	hsa-miR-4511	CLIP-seq
MIRT1977546	hsa-miR-4533	CLIP-seq
MIRT937611	hsa-miR-4662a-3p	CLIP-seq
MIRT937612	hsa-miR-4694-3p	CLIP-seq
MIRT1977547	hsa-miR-4694-5p	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT1977548	hsa-miR-4698	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT1977549	hsa-miR-4720-3p	CLIP-seq
MIRT1977550	hsa-miR-4733-5p	CLIP-seq
MIRT937617	hsa-miR-4773	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937619	hsa-miR-4789-3p	CLIP-seq
MIRT1977551	hsa-miR-4804-3p	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT1977552	hsa-miR-508-5p	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937641	hsa-miR-522	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT1977553	hsa-miR-543	CLIP-seq
MIRT937643	hsa-miR-548ae	CLIP-seq
MIRT937644	hsa-miR-548aj	CLIP-seq
MIRT937645	hsa-miR-548am	CLIP-seq
MIRT937646	hsa-miR-548b-3p	CLIP-seq
MIRT937649	hsa-miR-548x	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT1977554	hsa-miR-567	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT1977555	hsa-miR-578	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT1977556	hsa-miR-600	CLIP-seq
MIRT1977557	hsa-miR-613	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT1977558	hsa-miR-654-3p	CLIP-seq
MIRT1977559	hsa-miR-934	CLIP-seq
MIRT937663	hsa-miR-940	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq

Transcription factors

Show/Hide all(12)

Transcription factor	Regulation	Reference
ASCL1	Repression	19744316
GATA6	Unknown	21811562
MSC	Unknown	19148141
MSX1	Repression	22455953
MYC	Repression	20697356
MYC	Unknown	17964517
NANOG	Unknown	19148141
POU5F1	Repression	17068183
SOX2	Activation	22015605
TP53	Unknown	15229249
TWIST1	Unknown	18453541
TWIST2	Unknown	18453541

Show/Hide all(80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20723538
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001706	Process	Endoderm formation	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0002090	Process	Regulation of receptor internalization	IDA	17804805
GO:0003129	Process	Heart induction	IEA
GO:0003129	Process	Heart induction	ISS
GO:0003170	Process	Heart valve development	ISS
GO:0003197	Process	Endocardial cushion development	ISS
GO:0005515	Function	Protein binding	IPI	11448771, 16189514, 17804805, 19060904, 21944579, 21984209, 27524201, 28514442, 31515488, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11448771, 11742004
GO:0005886	Component	Plasma membrane	IDA	16263759
GO:0007492	Process	Endoderm development	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0008083	Function	Growth factor activity	TAS	10383463
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	23164821
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	15020244, 22615920
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	ISS
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032526	Process	Response to retinoic acid	IEA
GO:0039706	Function	Co-receptor binding	IBA
GO:0039706	Function	Co-receptor binding	IPI	11433302, 20093360
GO:0039706	Function	Co-receptor binding	TAS	22988876
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	IDA	20559569
GO:0042663	Process	Regulation of endodermal cell fate specification	IDA	20559569
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	TAS	23164821
GO:0045813	Process	Positive regulation of Wnt signaling pathway, calcium modulating pathway	TAS	23164821
GO:0046330	Process	Positive regulation of JNK cascade	IDA	23164821
GO:0048019	Function	Receptor antagonist activity	IBA
GO:0048019	Function	Receptor antagonist activity	IDA	20723538
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IDA	16263759
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060173	Process	Limb development	IEA
GO:0060173	Process	Limb development	ISS
GO:0060323	Process	Head morphogenesis	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	20559569
GO:0061743	Process	Motor learning	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11433302, 11448771, 11742004, 12857724, 17804805, 18044981, 20039315, 20093360, 20559569, 20723538, 22902902
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	18166153
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	27846906
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	NAS	24431302
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	23164821, 24449494
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0098883	Process	Synapse pruning	TAS	24449494
GO:1904338	Process	Regulation of dopaminergic neuron differentiation	TAS	24431302
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IDA	11448771, 20093360
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IPI	11433302
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	TAS	23164821
GO:1904958	Process	Positive regulation of midbrain dopaminergic neuron differentiation	IEA
GO:1905607	Process	Negative regulation of presynapse assembly	IEA
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	TAS	23164821
GO:2000726	Process	Negative regulation of cardiac muscle cell differentiation	IDA	20559569

MIM	HGNC	e!Ensembl
605189	2891	ENSG00000107984

Protein

UniProt ID

O94907

Protein name

Dickkopf-related protein 1 (Dickkopf-1) (Dkk-1) (hDkk-1) (SK)

Protein function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6 (PubMed:22000856). DKKs play an important role in verteb

PDB

3S2K , 3S8V , 3SOQ , 5FWW , 5GJE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04706	Dickkopf_N	84 → 139	Dickkopf N-terminal cysteine-rich region	Family

Tissue specificity

TISSUE SPECIFICITY: Placenta.

Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR
CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG
EGLSCRIQKDHHQASNSSRLHTCQRH

Sequence length

266

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases		Negative regulation of TCF-dependent signaling by WNT ligand antagonists Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling

DKK1 (dickkopf Wnt signaling pathway inhibitor 1)