Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22943
Gene name	Dickkopf Wnt signaling pathway inhibitor 1
Gene symbol	DKK1
Synonyms (NCBI Gene)	DKK-1SK
Chromosome	10
Chromosome location	10q21.1
Summary	This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibit

355

Show/Hide all (355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003609	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	20551325
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT005874	hsa-miR-31-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21048943
MIRT023613	hsa-miR-1-3p	Microarray	18668037
MIRT052959	hsa-miR-371a-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT053299	hsa-miR-372-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT053300	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	22020335
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT732132	hsa-miR-493-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26799283
MIRT053300	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	28337453
MIRT053300	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	28337453
MIRT736120	hsa-miR-335-5p	qRT-PCRWestern blot	26986081
MIRT733475	hsa-miR-106a-5p	qRT-PCR	34184078
MIRT733476	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT735711	hsa-miR-107	Luciferase reporter assayWestern blottingqRT-PCR	34234100
MIRT736120	hsa-miR-335-5p	Luciferase reporter assayWestern blottingqRT-PCR	31679313
MIRT735711	hsa-miR-107	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRFlow cytometry	34234100
MIRT756012	hsa-miR-5584-3p	Luciferase reporter assayWestern blottingqRT-PCRRNA-seq	38883346
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937544	hsa-miR-103a	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937547	hsa-miR-1261	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT937550	hsa-miR-148a	CLIP-seq
MIRT937551	hsa-miR-148b	CLIP-seq
MIRT937552	hsa-miR-152	CLIP-seq
MIRT937553	hsa-miR-186	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937558	hsa-miR-2682	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937565	hsa-miR-3065-3p	CLIP-seq
MIRT937566	hsa-miR-3125	CLIP-seq
MIRT937567	hsa-miR-3133	CLIP-seq
MIRT937568	hsa-miR-3140-3p	CLIP-seq
MIRT937569	hsa-miR-3148	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937571	hsa-miR-3163	CLIP-seq
MIRT937572	hsa-miR-320e	CLIP-seq
MIRT937573	hsa-miR-329	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937576	hsa-miR-33a	CLIP-seq
MIRT937577	hsa-miR-33b	CLIP-seq
MIRT937578	hsa-miR-34a	CLIP-seq
MIRT937579	hsa-miR-34c-5p	CLIP-seq
MIRT937580	hsa-miR-3613-3p	CLIP-seq
MIRT937581	hsa-miR-362-3p	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937583	hsa-miR-3653	CLIP-seq
MIRT937584	hsa-miR-3658	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937590	hsa-miR-3916	CLIP-seq
MIRT937591	hsa-miR-3921	CLIP-seq
MIRT937592	hsa-miR-3941	CLIP-seq
MIRT937593	hsa-miR-3942-3p	CLIP-seq
MIRT937594	hsa-miR-3944-5p	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT937601	hsa-miR-4317	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937603	hsa-miR-4420	CLIP-seq
MIRT937604	hsa-miR-449a	CLIP-seq
MIRT937605	hsa-miR-449b	CLIP-seq
MIRT937606	hsa-miR-449c	CLIP-seq
MIRT937607	hsa-miR-4503	CLIP-seq
MIRT937608	hsa-miR-4509	CLIP-seq
MIRT937609	hsa-miR-4511	CLIP-seq
MIRT937610	hsa-miR-4653-5p	CLIP-seq
MIRT937611	hsa-miR-4662a-3p	CLIP-seq
MIRT937612	hsa-miR-4694-3p	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT937616	hsa-miR-4768-5p	CLIP-seq
MIRT937617	hsa-miR-4773	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937619	hsa-miR-4789-3p	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937626	hsa-miR-511	CLIP-seq
MIRT937627	hsa-miR-513a-3p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937641	hsa-miR-522	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT937643	hsa-miR-548ae	CLIP-seq
MIRT937644	hsa-miR-548aj	CLIP-seq
MIRT937645	hsa-miR-548am	CLIP-seq
MIRT937646	hsa-miR-548b-3p	CLIP-seq
MIRT937647	hsa-miR-548n	CLIP-seq
MIRT937648	hsa-miR-548t	CLIP-seq
MIRT937649	hsa-miR-548x	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT937651	hsa-miR-561	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT937656	hsa-miR-587	CLIP-seq
MIRT937657	hsa-miR-590-3p	CLIP-seq
MIRT937658	hsa-miR-603	CLIP-seq
MIRT937659	hsa-miR-607	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT937663	hsa-miR-940	CLIP-seq
MIRT1977534	hsa-miR-1	CLIP-seq
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937544	hsa-miR-103a	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937547	hsa-miR-1261	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT1977535	hsa-miR-1468	CLIP-seq
MIRT937550	hsa-miR-148a	CLIP-seq
MIRT937551	hsa-miR-148b	CLIP-seq
MIRT937552	hsa-miR-152	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT1977536	hsa-miR-206	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937558	hsa-miR-2682	CLIP-seq
MIRT1977537	hsa-miR-297	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937565	hsa-miR-3065-3p	CLIP-seq
MIRT937566	hsa-miR-3125	CLIP-seq
MIRT937568	hsa-miR-3140-3p	CLIP-seq
MIRT1977538	hsa-miR-3143	CLIP-seq
MIRT1977539	hsa-miR-3145-3p	CLIP-seq
MIRT937569	hsa-miR-3148	CLIP-seq
MIRT1977540	hsa-miR-3156-5p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937571	hsa-miR-3163	CLIP-seq
MIRT1977541	hsa-miR-3202	CLIP-seq
MIRT937572	hsa-miR-320e	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937578	hsa-miR-34a	CLIP-seq
MIRT937579	hsa-miR-34c-5p	CLIP-seq
MIRT1977542	hsa-miR-3618	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937583	hsa-miR-3653	CLIP-seq
MIRT937584	hsa-miR-3658	CLIP-seq
MIRT1977543	hsa-miR-3673	CLIP-seq
MIRT1977544	hsa-miR-3674	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937590	hsa-miR-3916	CLIP-seq
MIRT937593	hsa-miR-3942-3p	CLIP-seq
MIRT937594	hsa-miR-3944-5p	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT1977545	hsa-miR-433	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937603	hsa-miR-4420	CLIP-seq
MIRT937604	hsa-miR-449a	CLIP-seq
MIRT937605	hsa-miR-449b	CLIP-seq
MIRT937606	hsa-miR-449c	CLIP-seq
MIRT937607	hsa-miR-4503	CLIP-seq
MIRT937608	hsa-miR-4509	CLIP-seq
MIRT937609	hsa-miR-4511	CLIP-seq
MIRT1977546	hsa-miR-4533	CLIP-seq
MIRT937611	hsa-miR-4662a-3p	CLIP-seq
MIRT937612	hsa-miR-4694-3p	CLIP-seq
MIRT1977547	hsa-miR-4694-5p	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT1977548	hsa-miR-4698	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT1977549	hsa-miR-4720-3p	CLIP-seq
MIRT1977550	hsa-miR-4733-5p	CLIP-seq
MIRT937617	hsa-miR-4773	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937619	hsa-miR-4789-3p	CLIP-seq
MIRT1977551	hsa-miR-4804-3p	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT1977552	hsa-miR-508-5p	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937641	hsa-miR-522	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT1977553	hsa-miR-543	CLIP-seq
MIRT937643	hsa-miR-548ae	CLIP-seq
MIRT937644	hsa-miR-548aj	CLIP-seq
MIRT937645	hsa-miR-548am	CLIP-seq
MIRT937646	hsa-miR-548b-3p	CLIP-seq
MIRT937649	hsa-miR-548x	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT1977554	hsa-miR-567	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT1977555	hsa-miR-578	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT1977556	hsa-miR-600	CLIP-seq
MIRT1977557	hsa-miR-613	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT1977558	hsa-miR-654-3p	CLIP-seq
MIRT1977559	hsa-miR-934	CLIP-seq
MIRT937663	hsa-miR-940	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937599	hsa-miR-4282	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937574	hsa-miR-331-5p	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937600	hsa-miR-4305	CLIP-seq
MIRT937618	hsa-miR-4777-5p	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937622	hsa-miR-502-5p	CLIP-seq
MIRT937629	hsa-miR-518d-5p	CLIP-seq
MIRT937632	hsa-miR-519b-5p	CLIP-seq
MIRT937634	hsa-miR-519c-5p	CLIP-seq
MIRT937638	hsa-miR-520c-5p	CLIP-seq
MIRT937642	hsa-miR-526a	CLIP-seq
MIRT937654	hsa-miR-579	CLIP-seq
MIRT937660	hsa-miR-616	CLIP-seq
MIRT937543	hsa-miR-101	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937546	hsa-miR-1227	CLIP-seq
MIRT937549	hsa-miR-144	CLIP-seq
MIRT937554	hsa-miR-203	CLIP-seq
MIRT937555	hsa-miR-217	CLIP-seq
MIRT937557	hsa-miR-223	CLIP-seq
MIRT937559	hsa-miR-302a	CLIP-seq
MIRT937560	hsa-miR-302b	CLIP-seq
MIRT937561	hsa-miR-302c	CLIP-seq
MIRT937562	hsa-miR-302d	CLIP-seq
MIRT937563	hsa-miR-302e	CLIP-seq
MIRT937564	hsa-miR-3064-3p	CLIP-seq
MIRT937575	hsa-miR-338-5p	CLIP-seq
MIRT937585	hsa-miR-3682-5p	CLIP-seq
MIRT937586	hsa-miR-372	CLIP-seq
MIRT937587	hsa-miR-373	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937596	hsa-miR-410	CLIP-seq
MIRT937597	hsa-miR-4251	CLIP-seq
MIRT937598	hsa-miR-4277	CLIP-seq
MIRT937602	hsa-miR-4418	CLIP-seq
MIRT937613	hsa-miR-4697-3p	CLIP-seq
MIRT937614	hsa-miR-4699-3p	CLIP-seq
MIRT937615	hsa-miR-4705	CLIP-seq
MIRT937623	hsa-miR-509-3-5p	CLIP-seq
MIRT937624	hsa-miR-5095	CLIP-seq
MIRT937625	hsa-miR-509-5p	CLIP-seq
MIRT937628	hsa-miR-513a-5p	CLIP-seq
MIRT937630	hsa-miR-519a	CLIP-seq
MIRT937631	hsa-miR-519b-3p	CLIP-seq
MIRT937633	hsa-miR-519c-3p	CLIP-seq
MIRT937635	hsa-miR-520a-3p	CLIP-seq
MIRT937636	hsa-miR-520b	CLIP-seq
MIRT937637	hsa-miR-520c-3p	CLIP-seq
MIRT937639	hsa-miR-520d-3p	CLIP-seq
MIRT937640	hsa-miR-520e	CLIP-seq
MIRT937650	hsa-miR-552	CLIP-seq
MIRT937655	hsa-miR-580	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq
MIRT937545	hsa-miR-103b	CLIP-seq
MIRT937548	hsa-miR-140-3p	CLIP-seq
MIRT937556	hsa-miR-219-1-3p	CLIP-seq
MIRT937570	hsa-miR-3159	CLIP-seq
MIRT937582	hsa-miR-362-5p	CLIP-seq
MIRT937588	hsa-miR-376a	CLIP-seq
MIRT937589	hsa-miR-376b	CLIP-seq
MIRT937595	hsa-miR-3974	CLIP-seq
MIRT937620	hsa-miR-493	CLIP-seq
MIRT937621	hsa-miR-500b	CLIP-seq
MIRT937652	hsa-miR-568	CLIP-seq
MIRT937653	hsa-miR-571	CLIP-seq
MIRT937661	hsa-miR-643	CLIP-seq
MIRT937662	hsa-miR-651	CLIP-seq

Show/Hide all (12)

Transcription factor	Regulation	Reference
ASCL1	Repression	19744316
GATA6	Unknown	21811562
MSC	Unknown	19148141
MSX1	Repression	22455953
MYC	Repression	20697356
MYC	Unknown	17964517
NANOG	Unknown	19148141
POU5F1	Repression	17068183
SOX2	Activation	22015605
TP53	Unknown	15229249
TWIST1	Unknown	18453541
TWIST2	Unknown	18453541

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20723538
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001706	Process	Endoderm formation	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0002090	Process	Regulation of receptor internalization	IDA	17804805
GO:0003129	Process	Heart induction	IEA
GO:0003129	Process	Heart induction	ISS
GO:0003170	Process	Heart valve development	ISS
GO:0003197	Process	Endocardial cushion development	ISS
GO:0005515	Function	Protein binding	IPI	11448771, 16189514, 17804805, 19060904, 21944579, 21984209, 27524201, 28514442, 31515488, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11448771, 11742004
GO:0005886	Component	Plasma membrane	IDA	16263759
GO:0007492	Process	Endoderm development	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0008083	Function	Growth factor activity	TAS	10383463
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	23164821
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	15020244, 22615920
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	ISS
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032526	Process	Response to retinoic acid	IEA
GO:0039706	Function	Co-receptor binding	IBA
GO:0039706	Function	Co-receptor binding	IPI	11433302, 20093360
GO:0039706	Function	Co-receptor binding	TAS	22988876
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	IDA	20559569
GO:0042663	Process	Regulation of endodermal cell fate specification	IDA	20559569
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	TAS	23164821
GO:0045813	Process	Positive regulation of Wnt signaling pathway, calcium modulating pathway	TAS	23164821
GO:0046330	Process	Positive regulation of JNK cascade	IDA	23164821
GO:0048019	Function	Receptor antagonist activity	IBA
GO:0048019	Function	Receptor antagonist activity	IDA	20723538
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IDA	16263759
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060173	Process	Limb development	IEA
GO:0060173	Process	Limb development	ISS
GO:0060323	Process	Head morphogenesis	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	20559569
GO:0061743	Process	Motor learning	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11433302, 11448771, 11742004, 12857724, 17804805, 18044981, 20039315, 20093360, 20559569, 20723538, 22902902
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	18166153
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	27846906
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	NAS	24431302
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	23164821, 24449494
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0098883	Process	Synapse pruning	TAS	24449494
GO:1904338	Process	Regulation of dopaminergic neuron differentiation	TAS	24431302
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IDA	11448771, 20093360
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IPI	11433302
GO:1904723	Process	Negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	TAS	23164821
GO:1904958	Process	Positive regulation of midbrain dopaminergic neuron differentiation	IEA
GO:1905607	Process	Negative regulation of presynapse assembly	IEA
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	TAS	23164821
GO:2000726	Process	Negative regulation of cardiac muscle cell differentiation	IDA	20559569

MIM	HGNC	e!Ensembl
605189	2891	ENSG00000107984

O94907

Protein name

Dickkopf-related protein 1 (Dickkopf-1) (Dkk-1) (hDkk-1) (SK)

Protein function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6 (PubMed:22000856). DKKs play an important role in verteb

PDB

3S2K , 3S8V , 3SOQ , 5FWW , 5GJE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04706	Dickkopf_N	84 → 139	Dickkopf N-terminal cysteine-rich region	Family

Tissue specificity

TISSUE SPECIFICITY: Placenta.

Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR
CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG
EGLSCRIQKDHHQASNSSRLHTCQRH

Sequence length

266

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases		Negative regulation of TCF-dependent signaling by WNT ligand antagonists Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
DKK1-related disorder	Likely benign	rs149268042, rs1173272726	RCV003914166 RCV003957160
Lung cancer	Benign; Likely benign	rs183951849	RCV005906718
Malignant tumor of esophagus	Benign; Likely benign	rs183951849	RCV005906715
Melanoma	Benign; Likely benign	rs183951849	RCV005906717
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs183951849	RCV005906716

Show/Hide Text Mining Associations (204)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Stimulate	23600832
Abortion Spontaneous	Associate	23600832
Acidosis	Associate	34993253
Acro Osteolysis	Associate	14695408, 17255354, 20846389, 26913608, 35145077
Acro Osteolysis	Stimulate	27310953
Adenocarcinoma	Associate	26297437, 33972574
Adenocarcinoma of Lung	Associate	33287749, 35437508, 35907982, 39766765
Adenoma	Associate	27245242
Alopecia	Associate	17657240, 21034532, 33917070
Alzheimer Disease	Associate	32831200, 35962130
Amyotrophic Lateral Sclerosis	Inhibit	25811776
Anodontia	Associate	28813618
Arnold Chiari Malformation	Associate	28513615
Arthritis	Associate	23079210, 23595579, 32068606
Arthritis Psoriatic	Associate	37834418
Arthritis Rheumatoid	Associate	25837853, 26350950, 26782930, 26785768, 30157923, 30171335, 30880318, 31019537, 32068606, 39337398
Arthropathy progressive pseudorheumatoid of childhood	Associate	35462544
Atherosclerosis	Associate	38175715, 40731833
Atypical Squamous Cells of the Cervix	Associate	31108390
Axial osteomalacia	Associate	26313358
Barrett Esophagus	Associate	19309775, 26297437
Beckwith Wiedemann Syndrome	Associate	35507738
Behcet Syndrome	Associate	33393726
Biliary Tract Neoplasms	Associate	35121803
Bone Diseases	Stimulate	14695408, 17129176, 18005268
Bone Diseases	Associate	17255354, 18978943, 19657367, 20653953, 20939046, 21856767, 22363428, 23079210, 23281130, 25182503, 25484108, 27310953, 30496210, 31687048, 33420361, 34875817, 35145077, 40226410 View all (3 more)
Bone Diseases	Inhibit	35277659, 36506070
Bone Diseases Metabolic	Stimulate	25484108
Brain Damage Chronic	Associate	34886821
Brain Neoplasms	Associate	29117471
Breast Neoplasms	Associate	17245340, 18283316, 18546262, 20139903, 22649545, 23861811, 24641868, 25116444, 26378045, 30320375, 30570852, 30941948, 33462997, 36788602, 38036593, 40226410 View all (1 more)
Breast Neoplasms	Inhibit	24770633
Bronchiolitis Obliterans Syndrome	Associate	33758171
Calcinosis	Inhibit	22874762
Calcinosis	Associate	36281932
Cap Myopathy	Associate	18978943
Carcinogenesis	Associate	17329407, 20920327, 21811562, 22966878, 23396252, 23922913, 25484078, 27608843, 27723845, 31568519
Carcinoma Endometrioid	Associate	37655078
Carcinoma Hepatocellular	Associate	20532728, 25344678, 26414287, 26960688, 27545991, 27723845, 29117471, 30929558, 31568519, 32815653, 36718957
Carcinoma Hepatocellular	Stimulate	24325363, 26256972, 27821026
Carcinoma Non Small Cell Lung	Associate	24391982, 26353782, 28677426, 34877784
Carcinoma Non Small Cell Lung	Stimulate	24612589
Carcinoma Ovarian Epithelial	Associate	19787627
Carcinoma Pancreatic Ductal	Stimulate	28749252
Carcinoma Pancreatic Ductal	Associate	34117362
Carcinoma Renal Cell	Associate	35983409
Carcinoma Squamous Cell	Associate	35340228
Cardiovascular Diseases	Associate	20665672
Cartilage Diseases	Associate	22736200
Cell Transformation Neoplastic	Associate	32269030
Cholangiocarcinoma	Associate	23132676
Chondrosarcoma	Associate	25144498, 27255549
Chronic Kidney Disease Mineral and Bone Disorder	Associate	21164019, 28493902
Cognition Disorders	Associate	34886821
Colonic Neoplasms	Associate	27245242
Colonic Polyps	Associate	22022386
Colorectal Neoplasms	Associate	18461655, 21304055, 22815877, 22966878, 25788273, 29164578, 33795652, 37090726
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Stimulate	23299503
Congenital central hypoventilation syndrome	Associate	23299503
COVID 19	Associate	36071553
Crohn Disease	Associate	31729323
Diabetes Mellitus	Inhibit	37728820
Diabetes Mellitus Type 2	Associate	24227537
DNA Virus Infections	Associate	24481601
Donohue Syndrome	Associate	20033851
Encephalitis Viral	Associate	24134157
Endometrial Hyperplasia	Associate	37655078
Endometrial Neoplasms	Associate	31865530, 37655078
Endometriosis	Associate	22259059
Epstein Barr Virus Infections	Inhibit	30745852
Esophageal Neoplasms	Associate	24391982, 32707495, 33275591, 33541291
Esophageal Squamous Cell Carcinoma	Associate	34117362
Fanconi Anemia	Associate	24469828
Fistula	Associate	24250816
Fluorosis Dental	Associate	34886821
Focal Cortical Dysplasia	Associate	40055364
Gastroesophageal Reflux	Associate	19309775, 24481601
Gastrointestinal Neoplasms	Associate	18461655
Gaucher Disease	Stimulate	33287247
Gaucher Disease	Associate	36506070
Glaucoma	Associate	27293372
Glioblastoma	Associate	21029453
Glioma	Associate	20920327, 21029453, 24770633
Heart Diseases	Associate	37039367
Heart Failure Diastolic	Associate	36184749
Hematologic Neoplasms	Associate	24469828
Hemolytic Uremic Syndrome	Associate	33574979
Hepatitis C	Associate	24947038, 27821026
Hepatoblastoma	Associate	12649343, 35507738
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17245340
HIV Infections	Associate	24134157
Hyperandrogenism	Associate	21611153
Hyperostosis Diffuse Idiopathic Skeletal	Inhibit	28153008
Hypertrophy	Associate	35946454
Hypoxia	Stimulate	24770633, 33420361
Hypoxia	Associate	34853621
Idiopathic Pulmonary Fibrosis	Associate	20650998
Infant Premature Diseases	Associate	36788602
Infections	Associate	36071553
Inflammation	Associate	19217321, 23028464, 23079210, 24481601, 25484078, 26782930, 27216891, 30947534, 31568519, 31687048, 31729323, 32068606, 33300071, 33574979, 35121803
Inflammation	Inhibit	35027825
Intervertebral Disc Degeneration	Associate	33233925
Intra Articular Fractures	Associate	37834418
Joint Diseases	Associate	19217321
Kidney Neoplasms	Associate	17245340
Klatskin Tumor	Associate	27608843
Leukemia Biphenotypic Acute	Associate	28263515
Leukemia Myeloid Acute	Associate	20795789, 28440495, 31842997, 34840706
Leukemia T Cell	Associate	17686056
Liver Cirrhosis	Inhibit	20532728
Lung Diseases	Stimulate	17245340
Lung Neoplasms	Associate	21048943, 21681374, 23396252, 24377567, 36718957
Lupus Erythematosus Systemic	Inhibit	34058801
Lupus Nephritis	Associate	24465439
Lymphatic Metastasis	Inhibit	18461655, 35340228
Lymphatic Metastasis	Associate	22649545, 23595579, 24391982, 25048826, 25116444, 26782465, 27608843, 28749252
Lymphatic Metastasis	Stimulate	23132676
Mallory Weiss Syndrome	Associate	33972574
Medulloblastoma	Associate	12649343, 17329407, 20823417, 23567267
Melanoma	Associate	24733089, 28067893
Metabolic Diseases	Associate	21611153
Microsatellite Instability	Associate	21304055
Migraine Disorders	Stimulate	35546551
Monoclonal Gammopathy of Undetermined Significance	Associate	35965418
Mouth Diseases	Stimulate	18561248
Mouth Neoplasms	Associate	25487617
Multiple Myeloma	Associate	14695408, 17255354, 17344918, 18005268, 19657367, 20438295, 20653953, 20846389, 22363428, 26601950, 30614800, 33420361, 34871540, 35965418
Multiple Myeloma	Stimulate	27310953
Muscular Dystrophy Duchenne	Associate	18021006
Musculoskeletal Abnormalities	Associate	36506070
Myocardial Infarction	Stimulate	38175715
Neoplasm Metastasis	Associate	18546262, 23132676, 23404437, 24324730, 24325363, 24612589, 25048826, 26782465, 26913608, 28337453, 31568519, 33613114, 33795652, 35296660, 37439806
Neoplasm Metastasis	Inhibit	18561248
Neoplasms	Associate	15542433, 17245340, 17344918, 17686056, 18978943, 20532728, 21304055, 21681374, 23132676, 23396252, 23404437, 23595579, 24377567, 24391982, 24553122 View all (21 more)
Neoplasms	Inhibit	17329407, 19247449, 22022386, 22363428, 23028975, 24770633, 25995040, 31568519
Neoplasms	Stimulate	19787627, 27310953, 27586146, 34117362
Neuroblastoma	Associate	24586304
Neurodegenerative Diseases	Associate	33287247
Oculocutaneous albinism type 1B	Inhibit	28153008
Oropharyngeal Neoplasms	Associate	25487617
Osseous Heteroplasia Progressive	Associate	28153008
Ossification of Posterior Longitudinal Ligament	Inhibit	28153008
Osteoarthritis	Associate	19217321, 27428952, 28953627, 29806631, 30903650, 30947534, 32819387
Osteoarthritis Hip	Associate	28275825
Osteoarthropathy Primary Hypertrophic	Associate	20042673
Osteoarthropathy Primary Hypertrophic	Inhibit	20042673
Osteonecrosis	Associate	30551361
Osteoporosis	Stimulate	20939046
Osteoporosis	Inhibit	21452281
Osteoporosis	Associate	22692843, 23595579, 26930606, 29504704, 30026596, 31197079, 31968132, 33939331, 34034718
Osteoporosis pseudoglioma syndrome	Associate	35237949
Osteosarcoma	Associate	12740383
Osteosarcoma	Inhibit	32723833
Ovarian Neoplasms	Associate	19787627, 21131918
Ovarian Neoplasms	Inhibit	33613114
Pain	Associate	36506070
Pancreatic Neoplasms	Associate	19744316, 21811562, 26101916, 34117362, 34143198, 34993253, 39487387
Pancreatitis Chronic	Associate	26101916
Parkinson Disease	Associate	34943986
Parkinson Disease Postencephalitic	Associate	24134157
Periodontitis	Associate	27216891
Plasmablastic Lymphoma	Associate	37105495
Pneumonia Aspiration	Stimulate	24481601
Polycystic Ovary Syndrome	Associate	21611153, 31745224
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17686056, 22095226
Premature Birth	Associate	36788602
Prostatic Hyperplasia	Stimulate	30116403
Prostatic Neoplasms	Inhibit	18478098
Prostatic Neoplasms	Associate	18561248, 25182503, 26913608
Prostatic Neoplasms	Stimulate	30116403
Psoriasis	Associate	20376066
Pulmonary Arterial Hypertension	Stimulate	37039367
Pulmonary Disease Chronic Obstructive	Inhibit	35027825
Renal Insufficiency Chronic	Inhibit	31687048
Retinal Diseases	Associate	27293372
Rickettsia Infections	Associate	23028464
Sacroiliitis	Associate	26313358
Sarcoma Ewing	Associate	19247449
Sjogren's Syndrome	Inhibit	34058801
Spinal Cord Injuries	Associate	25484108
Spondylarthropathies	Associate	35743102
Spondylitis Ankylosing	Associate	25518021, 26313358, 31656088, 37506134
Spondylitis Ankylosing	Inhibit	35743102
Squamous Cell Carcinoma of Head and Neck	Associate	28337453, 33281184, 35361159, 36007290, 36690301, 39282247
Stiff Skin Syndrome	Associate	30547685
Stomach Neoplasms	Stimulate	22496615
Stomach Neoplasms	Associate	28152305, 29720122, 31868807, 33661721, 34482288, 34746312, 36762306
Stomach Neoplasms	Inhibit	30593147, 31952791
Stroke	Stimulate	30496210
Temporomandibular Joint Disorders	Associate	26239269
Tertiary Lymphoid Structures	Stimulate	24612589
Thrombosis	Associate	23028464
Tooth Erosion	Associate	37834418
Triple Negative Breast Neoplasms	Associate	22649545
Tuberculosis Pulmonary	Associate	36569862
Turner Syndrome	Associate	35237949
Urinary Bladder Neoplasms	Associate	26782465
Uterine Cervical Dysplasia	Stimulate	23595579
Uterine Cervical Neoplasms	Stimulate	23595579
Uterine Diseases	Associate	19328470
Vascular Calcification	Associate	37179214, 37728820, 40731833
Vascular Diseases	Associate	37039367
Ventricular Remodeling	Associate	37039367
Wilms Tumor	Associate	12649343

DKK1 (dickkopf Wnt signaling pathway inhibitor 1)