Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22934
Gene name Gene Name - the full gene name approved by the HGNC.
Ribose 5-phosphate isomerase A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPIA
Synonyms (NCBI Gene) Gene synonyms aliases
RPI, RPIAD
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential r
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918591 C>T Pathogenic Coding sequence variant, missense variant
rs730880316 G>- Pathogenic Coding sequence variant, frameshift variant
rs1558699183 G>C Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002559 hsa-miR-373-3p Microarray 15685193
MIRT001851 hsa-let-7b-5p Luciferase reporter assay 15131085
MIRT019459 hsa-miR-148b-3p Microarray 17612493
MIRT002559 hsa-miR-373-3p Microarray;Other 15685193
MIRT022847 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004751 Function Ribose-5-phosphate isomerase activity EXP 14988808
GO:0004751 Function Ribose-5-phosphate isomerase activity IBA
GO:0004751 Function Ribose-5-phosphate isomerase activity IEA
GO:0004751 Function Ribose-5-phosphate isomerase activity NAS 7758956
GO:0004751 Function Ribose-5-phosphate isomerase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
180430 10297 ENSG00000153574
Protein
UniProt ID P49247
Protein name Ribose-5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase)
Protein function Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate and participates in the first step of the non-oxidative branch of the pentose phosphate pathway.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06026 Rib_5-P_isom_A 127 301 Ribose 5-phosphate isomerase A (phosphoriboisomerase A) Family
Sequence
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST
SCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVK
QENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT
QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELR
MAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD
G
SVNMREKPFC
Sequence length 311
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
  RPIA deficiency: failed conversion of R5P to RU5P
RPIA deficiency: failed conversion of RU5P to R5P
Pentose phosphate pathway
<