Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22933
Gene name Gene Name - the full gene name approved by the HGNC.	Sirtuin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SIRT2
Synonyms (NCBI Gene) Gene synonyms aliases	SIR2, SIR2L, SIR2L2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025871	hsa-miR-7-5p	Sequencing	20371350
MIRT438487	hsa-miR-21-5p	Western blot	24161395
MIRT438487	hsa-miR-21-5p	Western blot	24161395
MIRT025871	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT025871	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT734726	hsa-miR-339-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, ELISA	33849089
MIRT736562	hsa-miR-212-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34117507
MIRT756390	hsa-miR-106b-5p	Luciferase reporter assay, Western blotting	36308623
MIRT1350139	hsa-miR-323b-3p	CLIP-seq
MIRT1350140	hsa-miR-3908	CLIP-seq
MIRT1350141	hsa-miR-4775	CLIP-seq
MIRT1350142	hsa-miR-515-5p	CLIP-seq
MIRT1350143	hsa-miR-1275	CLIP-seq
MIRT1350144	hsa-miR-1303	CLIP-seq
MIRT1350145	hsa-miR-3152-3p	CLIP-seq
MIRT1350146	hsa-miR-3170	CLIP-seq
MIRT1350147	hsa-miR-3689d	CLIP-seq
MIRT1350148	hsa-miR-4266	CLIP-seq
MIRT1350149	hsa-miR-4488	CLIP-seq
MIRT1350150	hsa-miR-4503	CLIP-seq
MIRT1350151	hsa-miR-4665-5p	CLIP-seq
MIRT1350152	hsa-miR-4694-5p	CLIP-seq
MIRT1350153	hsa-miR-4695-5p	CLIP-seq
MIRT1350154	hsa-miR-4697-5p	CLIP-seq
MIRT1350155	hsa-miR-4708-5p	CLIP-seq
MIRT1350156	hsa-miR-4731-5p	CLIP-seq
MIRT1350157	hsa-miR-4757-5p	CLIP-seq
MIRT1350158	hsa-miR-4779	CLIP-seq
MIRT1350144	hsa-miR-1303	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ATF4	Repression	21801305
DDIT3	Repression	21801305

Show/Hide all(108)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18722353
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	23908241
GO:0000183	Process	RDNA heterochromatin assembly	NAS	11427894
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000792	Component	Heterochromatin	ISS
GO:0003682	Function	Chromatin binding	IDA	23908241
GO:0003950	Function	NAD+ ADP-ribosyltransferase activity	IDA	10381378
GO:0003950	Function	NAD+ ADP-ribosyltransferase activity	TAS	17456799
GO:0004407	Function	Histone deacetylase activity	IDA	17488717
GO:0005515	Function	Protein binding	IPI	12697818, 12887892, 17172643, 17726514, 18722353, 21081649, 21949390, 23932781, 24681946, 24769394, 24825348, 27512957
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15213244, 16648462, 17726514, 23908241
GO:0005677	Component	Chromatin silencing complex	NAS	12697818
GO:0005694	Component	Chromosome	IDA	16648462
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	12697818, 15213244, 16079181, 16648462, 17726514, 20543840, 23908241
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	17488717, 17726514
GO:0005814	Component	Centriole	IDA	17726514
GO:0005819	Component	Spindle	IDA	17726514
GO:0005829	Component	Cytosol	IDA	24681946
GO:0005874	Component	Microtubule	IDA	12620231
GO:0005886	Component	Plasma membrane	IDA
GO:0006342	Process	Chromatin silencing	NAS	12697818
GO:0006348	Process	Chromatin silencing at telomere	NAS	11427894
GO:0006471	Process	Protein ADP-ribosylation	IDA	10381378
GO:0006471	Process	Protein ADP-ribosylation	TAS	17456799
GO:0006476	Process	Protein deacetylation	IDA	17172643, 20543840, 21949390
GO:0006476	Process	Protein deacetylation	IMP	24681946
GO:0006914	Process	Autophagy	IEA
GO:0007096	Process	Regulation of exit from mitosis	NAS	12697818
GO:0008134	Function	Transcription factor binding	IBA	21873635
GO:0008134	Function	Transcription factor binding	IPI	12887892, 15126506, 15213244, 20543840
GO:0008270	Function	Zinc ion binding	IDA	11427894
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17488717
GO:0010507	Process	Negative regulation of autophagy	IMP	20543840
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	ISS
GO:0014065	Process	Phosphatidylinositol 3-kinase signaling	IMP	23908241
GO:0016575	Process	Histone deacetylation	TAS	12697818
GO:0017136	Function	NAD-dependent histone deacetylase activity	IBA	21873635
GO:0017136	Function	NAD-dependent histone deacetylase activity	IDA	11427894, 12697818
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0022011	Process	Myelination in peripheral nervous system	ISS
GO:0030426	Component	Growth cone	IEA
GO:0030496	Component	Midbody	IDA	17726514
GO:0031641	Process	Regulation of myelination	ISS
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0033010	Component	Paranodal junction	ISS
GO:0033270	Component	Paranode region of axon	ISS
GO:0033558	Function	Protein deacetylase activity	IDA	17172643, 20543840
GO:0033558	Function	Protein deacetylase activity	IMP	23908241
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0034979	Function	NAD-dependent protein deacetylase activity	IDA	18722353, 21949390, 23932781
GO:0034979	Function	NAD-dependent protein deacetylase activity	IMP	24681946
GO:0034983	Process	Peptidyl-lysine deacetylation	IDA	23932781
GO:0035035	Function	Histone acetyltransferase binding	IPI	12887892
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IDA	23908241
GO:0042177	Process	Negative regulation of protein catabolic process	IMP	20543840
GO:0042325	Process	Regulation of phosphorylation	NAS	12697818
GO:0042826	Function	Histone deacetylase binding	IPI	12620231
GO:0042903	Function	Tubulin deacetylase activity	IDA	12620231, 18722353, 23886946
GO:0043130	Function	Ubiquitin binding	IDA	12697818
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21841822
GO:0043204	Component	Perikaryon	ISS
GO:0043209	Component	Myelin sheath	ISS
GO:0043219	Component	Lateral loop	ISS
GO:0043220	Component	Schmidt-Lanterman incisure	ISS
GO:0043388	Process	Positive regulation of DNA binding	ISS
GO:0043491	Process	Protein kinase B signaling	IMP	23908241
GO:0044224	Component	Juxtaparanode region of axon	ISS
GO:0044242	Process	Cellular lipid catabolic process	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045836	Process	Positive regulation of meiotic nuclear division	ISS
GO:0045843	Process	Negative regulation of striated muscle tissue development	IDA	12887892
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	12887892
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046970	Function	NAD-dependent histone deacetylase activity (H4-K16 specific)	IDA	16648462
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IDA	23908241
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	17726514
GO:0051775	Process	Response to redox state	NAS	12887892
GO:0051781	Process	Positive regulation of cell division	ISS
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	ISS
GO:0061428	Process	Negative regulation of transcription from RNA polymerase II promoter in response to hypoxia	IMP	24681946
GO:0061433	Process	Cellular response to caloric restriction	ISS
GO:0070403	Function	NAD+ binding	IBA	21873635
GO:0070403	Function	NAD+ binding	IDA	11427894
GO:0070446	Process	Negative regulation of oligodendrocyte progenitor proliferation	ISS
GO:0070932	Process	Histone H3 deacetylation	IMP	23908241
GO:0070933	Process	Histone H4 deacetylation	IDA	16648462, 17488717
GO:0071219	Process	Cellular response to molecule of bacterial origin	IDA	23908241
GO:0071456	Process	Cellular response to hypoxia	IDA	24681946
GO:0071872	Process	Cellular response to epinephrine stimulus	ISS
GO:0072686	Component	Mitotic spindle	IDA	17488717
GO:0072687	Component	Meiotic spindle	ISS
GO:0090042	Process	Tubulin deacetylation	IDA	18722353, 23886946
GO:0090042	Process	Tubulin deacetylation	IMP	24681946
GO:0090042	Process	Tubulin deacetylation	ISS
GO:0097386	Component	Glial cell projection	ISS
GO:1900119	Process	Positive regulation of execution phase of apoptosis	ISS
GO:1900195	Process	Positive regulation of oocyte maturation	ISS
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900425	Process	Negative regulation of defense response to bacterium	IMP	23908241
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	ISS
GO:2000777	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved in cellular response to hypoxia	IMP	24681946

MIM	HGNC	e!Ensembl
604480	10886	ENSG00000068903

Protein

UniProt ID

Q8IXJ6

Protein name

NAD-dependent protein deacetylase sirtuin-2 (EC 2.3.1.286) (NAD-dependent protein defatty-acylase sirtuin-2) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 2) (SIR2-like protein 2)

Protein function

NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (PubMed:12620231, PubMed:16648462, PubMed:18249187, PubMed:18332217, PubMed:1899

PDB

1J8F , 3ZGO , 3ZGV , 4L3O , 4R8M , 4RMG , 4RMH , 4RMI , 4RMJ , 4X3O , 4X3P , 4Y6L , 4Y6O , 4Y6Q , 5D7O , 5D7P , 5D7Q , 5DY4 , 5DY5 , 5FYQ , 5G4C , 5MAR , 5MAT , 5Y0Z , 5Y5N , 5YQL , 5YQM , 5YQN , 5YQO , 6L65 , 6L66 , 6L71 , 6L72 , 6NR0 , 6QCN , 7BOS , 7BOT , 8OWZ , 8PY3 , 8QOO , 8QT0 , 8QT1 , 8QT2 , 8QT3 , 8QT4 , 8QT8 , 8QTU , 8TGP , 8XE7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02146	SIR2	84 → 268	Sir2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in heart, liver and skeletal muscle, weakly expressed in the cortex. Isoform 2 is strongly expressed in the cortex, weakly expressed in heart and liver. Weakly expressed in several malignancies including breast,

Sequence

MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways		Initiation of Nuclear Envelope (NE) Reformation

SIRT2 (sirtuin 2)