Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22933
Gene name	Sirtuin 2
Gene symbol	SIRT2
Synonyms (NCBI Gene)	SIR2SIR2LSIR2L2
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025871	hsa-miR-7-5p	Sequencing	20371350
MIRT438487	hsa-miR-21-5p	Western blot	24161395
MIRT438487	hsa-miR-21-5p	Western blot	24161395
MIRT025871	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT025871	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT734726	hsa-miR-339-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCRELISA	33849089
MIRT736562	hsa-miR-212-5p	Luciferase reporter assayWestern blottingqRT-PCR	34117507
MIRT756390	hsa-miR-106b-5p	Luciferase reporter assayWestern blotting	36308623
MIRT1350139	hsa-miR-323b-3p	CLIP-seq
MIRT1350140	hsa-miR-3908	CLIP-seq
MIRT1350141	hsa-miR-4775	CLIP-seq
MIRT1350142	hsa-miR-515-5p	CLIP-seq
MIRT1350143	hsa-miR-1275	CLIP-seq
MIRT1350144	hsa-miR-1303	CLIP-seq
MIRT1350145	hsa-miR-3152-3p	CLIP-seq
MIRT1350146	hsa-miR-3170	CLIP-seq
MIRT1350147	hsa-miR-3689d	CLIP-seq
MIRT1350148	hsa-miR-4266	CLIP-seq
MIRT1350149	hsa-miR-4488	CLIP-seq
MIRT1350150	hsa-miR-4503	CLIP-seq
MIRT1350151	hsa-miR-4665-5p	CLIP-seq
MIRT1350152	hsa-miR-4694-5p	CLIP-seq
MIRT1350153	hsa-miR-4695-5p	CLIP-seq
MIRT1350154	hsa-miR-4697-5p	CLIP-seq
MIRT1350155	hsa-miR-4708-5p	CLIP-seq
MIRT1350156	hsa-miR-4731-5p	CLIP-seq
MIRT1350157	hsa-miR-4757-5p	CLIP-seq
MIRT1350158	hsa-miR-4779	CLIP-seq
MIRT1350144	hsa-miR-1303	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF4	Repression	21801305
DDIT3	Repression	21801305

170

Show/Hide all (170)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18722353
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	24681946
GO:0000183	Process	RDNA heterochromatin formation	IBA
GO:0000183	Process	RDNA heterochromatin formation	NAS	11427894
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000792	Component	Heterochromatin	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003682	Function	Chromatin binding	IDA	23908241
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	10381378
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0004407	Function	Histone deacetylase activity	IDA	17488717
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0005515	Function	Protein binding	IPI	12697818, 12887892, 15213244, 17172643, 17726514, 18722353, 20543840, 21081649, 21653829, 21949390, 22014574, 23932781, 24681946, 24769394, 24825348, 27512957
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15213244, 16648462, 17726514, 23908241, 24177535
GO:0005634	Component	Nucleus	IEA
GO:0005677	Component	Chromatin silencing complex	NAS	12697818
GO:0005694	Component	Chromosome	IDA	16648462
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	12697818, 15213244, 16079181, 16648462, 17726514, 20543840, 23908241, 24177535
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	17488717, 17726514
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IDA	17726514
GO:0005814	Component	Centriole	IEA
GO:0005819	Component	Spindle	IDA	17726514
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	24681946
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	12620231
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006476	Process	Protein deacetylation	IDA	24177535
GO:0006476	Process	Protein deacetylation	IDA	20543840, 21949390, 24177535
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	23932781
GO:0006633	Process	Fatty acid biosynthetic process	IDA	10653665, 19286649
GO:0006914	Process	Autophagy	IEA
GO:0007084	Process	Mitotic nuclear membrane reassembly	TAS
GO:0007096	Process	Regulation of exit from mitosis	NAS	12697818
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IDA	11427894
GO:0010507	Process	Negative regulation of autophagy	IMP	20543840
GO:0010801	Process	Negative regulation of peptidyl-threonine phosphorylation	ISS
GO:0014816	Process	Skeletal muscle satellite cell differentiation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016042	Process	Lipid catabolic process	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IBA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	24177535
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	11427894, 12697818, 24177535
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0022011	Process	Myelination in peripheral nervous system	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030496	Component	Midbody	IDA	17726514
GO:0030496	Component	Midbody	IEA
GO:0031507	Process	Heterochromatin formation	NAS	12697818
GO:0031509	Process	Subtelomeric heterochromatin formation	NAS	11427894
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	24681946
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0033010	Component	Paranodal junction	IEA
GO:0033010	Component	Paranodal junction	ISS
GO:0033270	Component	Paranode region of axon	ISS
GO:0033558	Function	Protein lysine deacetylase activity	IDA	17172643, 20543840
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	23908241
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	18722353, 21949390, 23932781
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IMP	24681946
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0034983	Process	Peptidyl-lysine deacetylation	IDA	23932781
GO:0035035	Function	Histone acetyltransferase binding	IPI	12887892
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IMP	23908241
GO:0042177	Process	Negative regulation of protein catabolic process	IMP	20543840
GO:0042325	Process	Regulation of phosphorylation	NAS	12697818
GO:0042826	Function	Histone deacetylase binding	IPI	12620231
GO:0042903	Function	Tubulin deacetylase activity	IDA	24177535
GO:0042903	Function	Tubulin deacetylase activity	IDA	12620231, 18722353, 23886946, 24177535
GO:0042903	Function	Tubulin deacetylase activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043130	Function	Ubiquitin binding	IDA	12697818
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21841822
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0043209	Component	Myelin sheath	IEA
GO:0043209	Component	Myelin sheath	ISS
GO:0043219	Component	Lateral loop	ISS
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0043220	Component	Schmidt-Lanterman incisure	ISS
GO:0043388	Process	Positive regulation of DNA binding	ISS
GO:0043687	Process	Post-translational protein modification	IEA
GO:0044224	Component	Juxtaparanode region of axon	ISS
GO:0044546	Process	NLRP3 inflammasome complex assembly	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045836	Process	Positive regulation of meiotic nuclear division	IEA
GO:0045836	Process	Positive regulation of meiotic nuclear division	ISS
GO:0045843	Process	Negative regulation of striated muscle tissue development	IDA	12887892
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12887892
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IDA	16648462
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051093	Process	Negative regulation of developmental process	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051287	Function	NAD binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	17726514
GO:0051775	Process	Response to redox state	NAS	12887892
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051781	Process	Positive regulation of cell division	ISS
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	IEA
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	ISS
GO:0061433	Process	Cellular response to caloric restriction	IEA
GO:0061433	Process	Cellular response to caloric restriction	ISS
GO:0062013	Process	Positive regulation of small molecule metabolic process	IEA
GO:0070403	Function	NAD+ binding	IDA	11427894
GO:0070403	Function	NAD+ binding	IEA
GO:0070446	Process	Negative regulation of oligodendrocyte progenitor proliferation	ISS
GO:0071456	Process	Cellular response to hypoxia	IDA	24681946
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0071872	Process	Cellular response to epinephrine stimulus	ISS
GO:0072686	Component	Mitotic spindle	IDA	17488717
GO:0072687	Component	Meiotic spindle	IEA
GO:0072687	Component	Meiotic spindle	ISS
GO:0090042	Process	Tubulin deacetylation	IDA	24177535
GO:0090042	Process	Tubulin deacetylation	IDA	18722353, 24177535
GO:0090042	Process	Tubulin deacetylation	ISS
GO:0097386	Component	Glial cell projection	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IPI	12887892, 15126506
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IDA	25704306, 32103017
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IDA	32103017
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	ISS
GO:1900195	Process	Positive regulation of oocyte maturation	IEA
GO:1900195	Process	Positive regulation of oocyte maturation	ISS
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IEA
GO:1902725	Process	Negative regulation of satellite cell differentiation	ISS
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	ISS

MIM	HGNC	e!Ensembl
604480	10886	ENSG00000068903

Q8IXJ6

Protein name

NAD-dependent protein deacetylase sirtuin-2 (EC 2.3.1.286) (NAD-dependent protein defatty-acylase sirtuin-2) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 2) (SIR2-like protein 2)

Protein function

NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (PubMed:12620231, PubMed:16648462, PubMed:18249187, PubMed:18332217, PubMed:1899

PDB

1J8F , 3ZGO , 3ZGV , 4L3O , 4R8M , 4RMG , 4RMH , 4RMI , 4RMJ , 4X3O , 4X3P , 4Y6L , 4Y6O , 4Y6Q , 5D7O , 5D7P , 5D7Q , 5DY4 , 5DY5 , 5FYQ , 5G4C , 5MAR , 5MAT , 5Y0Z , 5Y5N , 5YQL , 5YQM , 5YQN , 5YQO , 6L65 , 6L66 , 6L71 , 6L72 , 6NR0 , 6QCN , 7BOS , 7BOT , 8OWZ , 8PY3 , 8QOO , 8QT0 , 8QT1 , 8QT2 , 8QT3 , 8QT4 , 8QT8 , 8QTU , 8TGP , 8XE7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02146	SIR2	84 → 268	Sir2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in heart, liver and skeletal muscle, weakly expressed in the cortex. Isoform 2 is strongly expressed in the cortex, weakly expressed in heart and liver. Weakly expressed in several malignancies including breast,

Sequence

MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways		Initiation of Nuclear Envelope (NE) Reformation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (75)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	23509313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	30871086	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Stimulate	34440700	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	40306441	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Associate	34963488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Stimulate	34344401	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	23340254, 24457910, 27725455, 33789098, 35408848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	23800187, 28259910, 28461331, 30081901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Inhibit	28461331	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Inhibit	26631040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30111572, 32493816, 35688384, 36308411	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	25915617	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	26942878	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	26121130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	37096064	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	28514749, 32141187, 33450304, 35264593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	28445509	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Associate	28600779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	32271403	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	32438712, 37062555, 39788488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Associate	33096729	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	39788488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	38336992	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	31510043	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	26701732, 37723477	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Stimulate	33327875	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Post Traumatic	Inhibit	38557165	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromyalgia	Associate	35693781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	37777567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	34359896	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulosa Cell Tumor	Associate	33669567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders Nervous System	Associate	36135988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	28445509, 29693338, 35693781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	32271403, 39463224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Associate	28600779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Associate	33616302	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	39788488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	22207684, 28053092, 30081901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	23108383, 26794150	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Associate	22207684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	22207684, 27291931, 30081901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Inhibit	37777567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	25915617, 36453571	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Inhibit	26942878	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	28166441	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	32176025	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibular Nerve Injuries	Associate	35408848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	16247014, 28166441, 28882678, 34068624	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Associate	34476507, 35669651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	28445509	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	24362520	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	29262808, 32141187	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22982396, 23175188, 23800187, 24362520, 25794641, 25915617, 27725455, 27875273, 28259910, 28514749, 28582846, 29693338, 30081901, 32541517, 33789098, 35136826, 37395399, 37723477 View all (3 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	26631040, 26942878, 28461331, 29262808, 29908203, 32176025, 35264593, 38554113	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuralgia	Associate	35408848, 36855217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	23175188	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	27875273, 30081901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurotoxicity Syndromes	Associate	24145446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	39463224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Inhibit	28259910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	32541517, 35941978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain Postoperative	Associate	35408848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	23175188	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	30562735, 31214610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	25884180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Associate	27875273	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	19075016, 26847404, 29262808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms Castration Resistant	Associate	37477521	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	20562129	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	23475622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	28061480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Associate	37794467	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	35136826	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	25794641, 32176025	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Associate	26940009	★★★★★ ★☆☆☆☆ Found in Text Mining only

SIRT2 (sirtuin 2)