Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22932
Gene name Gene Name - the full gene name approved by the HGNC.
POM121 and ZP3 fusion
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POMZP3
Synonyms (NCBI Gene) Gene synonyms aliases
POM-ZP3
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3` exons from the ZP3 gene. The 5` end of this gene is similar to the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023382 hsa-miR-122-5p Microarray 17612493
MIRT1250116 hsa-miR-140-3p CLIP-seq
MIRT1250117 hsa-miR-3166 CLIP-seq
MIRT1250118 hsa-miR-4270 CLIP-seq
MIRT1250119 hsa-miR-4441 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005654 Component Nucleoplasm IDA
GO:0007339 Process Binding of sperm to zona pellucida IBA 21873635
GO:0008150 Process Biological_process ND
GO:0031012 Component Extracellular matrix IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600587 9203 ENSG00000146707
Protein
UniProt ID Q6PJE2
Protein name POM121 and ZP3 fusion protein (POM-ZP3)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00100 Zona_pellucida 67 139 Zona pellucida-like domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, thymus, pancreas, testis, ovary, small intestine, colon and lymphocytes. {ECO:0000269|PubMed:7789967}.
Sequence
MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTV
EEEDQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITC
HLKVTLAEQDPDELNKACS
FSKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQ
WSTSASL
Sequence length 187
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cone dystrophy Cone Dystrophy rs121918537, rs796051871, rs104893967, rs61750172, rs61750173, rs606231180, rs606231181, rs61755783, rs61749668, rs61753046, rs762426409, rs374805348, rs794727197, rs863224908, rs869320709
View all (28 more)
28041643