PLA2R1 (phospholipase A2 receptor 1)

Gene

• Entrez ID: 22925
• Gene name: Phospholipase A2 receptor 1
• Gene symbol: PLA2R1
• Synonyms (NCBI Gene): CLEC13C, PLA2-R, PLA2G1R, PLA2IR, PLA2R
• Chromosome: 2
• Chromosome location: 2q24.2
• Summary: This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1238860	hsa-miR-3192	CLIP-seq
MIRT1238861	hsa-miR-4314	CLIP-seq
MIRT1238862	hsa-miR-4646-5p	CLIP-seq
MIRT1238863	hsa-miR-4694-5p	CLIP-seq
MIRT2297529	hsa-miR-3162-5p	CLIP-seq
MIRT2594912	hsa-miR-3145-3p	CLIP-seq
MIRT2594913	hsa-miR-490-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IMP	15611272
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	NAS	7721806
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12225974
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	7721806
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IDA	7721806
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0009986	Component	Cell surface	IDA	15611272
GO:0016020	Component	Membrane	IEA
GO:0019834	Function	Phospholipase A2 inhibitor activity	ISS
GO:0030246	Function	Carbohydrate binding	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IDA	7721806
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043274	Function	Phospholipase binding	IEA
GO:0043274	Function	Phospholipase binding	IPI	7721806
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IMP	19197340
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	19197340
GO:0090238	Process	Positive regulation of arachidonate secretion	IEA
GO:0090238	Process	Positive regulation of arachidonate secretion	ISS
GO:0090399	Process	Replicative senescence	IMP	19197340
GO:0090403	Process	Oxidative stress-induced premature senescence	IMP	19197340
GO:1900139	Process	Negative regulation of arachidonate secretion	ISS
GO:1904635	Process	Positive regulation of podocyte apoptotic process	IMP	25335547

Other IDs

• MIM: 604939
• HGNC: 9042
• e!Ensembl: ENSG00000153246

Protein

• UniProt ID: Q13018
• Protein name: Secretory phospholipase A2 receptor (PLA2-R) (PLA2R) (180 kDa secretory phospholipase A2 receptor) (C-type lectin domain family 13 member C) (M-type receptor) [Cleaved into: Soluble secretory phospholipase A2 receptor (Soluble PLA2-R) (Soluble PLA2R)]
• Protein function: Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phospholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its
• PDB: 6JLI, 7QSR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00040	fn2	178 → 219	Fibronectin type II domain	Domain
  PF00059	Lectin_C	249 → 356	Lectin C-type domain	Domain
  PF00059	Lectin_C	395 → 503	Lectin C-type domain	Domain
  PF00059	Lectin_C	547 → 645	Lectin C-type domain	Domain
  PF00059	Lectin_C	688 → 798	Lectin C-type domain	Domain
  PF00059	Lectin_C	830 → 939	Lectin C-type domain	Domain
  PF00059	Lectin_C	980 → 1098	Lectin C-type domain	Domain
  PF00059	Lectin_C	1131 → 1234	Lectin C-type domain	Domain
  PF00059	Lectin_C	1269 → 1379	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in podocytes (at protein level) (PubMed:25335547). Present in lung macrophage (at protein level). Highly expressed in kidney. Also expressed in pancreas, amnion, choriodecidua and placenta. Isoform 2 is expressed at much lowe
• Sequence:

  MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
  LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRK
  MITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
  PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
  ICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWMGLNQLDEH
  AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNH
  IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
  EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
  AEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
  SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEP
  VQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
  FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
  LLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGEDARNCAVYKAN
  KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
  SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
  TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPK
  GWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTS
  VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
  KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
  TCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
  EESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
  CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
  GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFICKME
  ADIHTAEALPEKGPSHSIIPLAVVLTLIVIVAICTLSFCIYKHNGGFFRRLAGFRNPYYP
  ATNFSTVYLEENILISDLEKSDQ

• Sequence length: 1463

Pathways

KEGG:

Phagosome
Tuberculosis

Reactome:

Acyl chain remodelling of PC
Acyl chain remodelling of PS
Acyl chain remodelling of PE
Acyl chain remodelling of PI
Acyl chain remodelling of PG
Synthesis of PA

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical hemolytic-uremic syndrome	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMBRANOUS GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	29792176	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	11786516	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	26672991	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	32751713	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Associate	23364522	★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Associate	14633610	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Associate	29792176	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Associate	20937089, 21323541, 22673885, 23364522, 23431073, 23813219, 24262501, 25394321, 26087695, 26222864, 26393352, 27025682, 27153925, 27355365, 27631233, 27852637, 27876003, 27934873, 28028136, 28397717, 29792176, 29881283, 30032157, 30173899, 30349113, 30619370, 32461964, 32678193, 32712166, 32879127, 32889013, 33157933, 33623956, 33637201, 33849930, 33874909, 33964912, 34083219, 34135910, 34497677, 34607530, 35333675, 35359934, 35484851, 35883046, 36588134, 37349681, 37535917, 38280123, 38423528, 39475016	★☆☆☆☆ Found in Text Mining only
Glomerulopathy with fibronectin deposits	Associate	27876003	★☆☆☆☆ Found in Text Mining only
Hematuria	Associate	39475016	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	33964912	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	29792176	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	22673885, 32678193, 38423528	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Associate	20937089	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	23217014	★☆☆☆☆ Found in Text Mining only
Leukemia Biphenotypic Acute	Associate	32493972	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	23217014	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	26222864	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Associate	26087695	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	23217014	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	23217014, 26672991, 32493972, 32751713	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25189995, 36221394	★☆☆☆☆ Found in Text Mining only
Nephritis	Associate	33002091	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Associate	32712166	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Associate	35883046, 39475016	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	25189995	★☆☆☆☆ Found in Text Mining only
Proteinuria	Associate	24262501, 25804280, 30868298, 32461964, 33874909	★☆☆☆☆ Found in Text Mining only
Proteinuria	Inhibit	30032157	★☆☆☆☆ Found in Text Mining only
Psoriasis	Inhibit	27876003	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Associate	38423528	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	36221394	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	26985959	★☆☆☆☆ Found in Text Mining only