Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22924
Gene name Gene Name - the full gene name approved by the HGNC.
Microtubule associated protein RP/EB family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAPRE3
Synonyms (NCBI Gene) Gene synonyms aliases
EB3, EBF3, EBF3-S, RP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020202 hsa-miR-130b-3p Sequencing 20371350
MIRT028081 hsa-miR-93-5p Sequencing 20371350
MIRT031142 hsa-miR-19b-3p Sequencing 20371350
MIRT088339 hsa-miR-130a-3p PAR-CLIP 20371350
MIRT020202 hsa-miR-130b-3p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10644998, 16189514, 19146815, 20195357, 21516116, 23572079, 25416956, 25814554, 27107012, 27173435, 29997244, 30668577, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm ISS 17310996
GO:0005815 Component Microtubule organizing center IBA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605788 6892 ENSG00000084764
Protein
UniProt ID Q9UPY8
Protein name Microtubule-associated protein RP/EB family member 3 (EB1 protein family member 3) (EBF3) (End-binding protein 3) (EB3) (RP3)
Protein function Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton (PubMed:19255245, PubMed:28814570). Promotes microtubule growth (PubMed:19255245, PubMed:28814570). May be inv
PDB 1WYO , 3CO1 , 3JAK , 3JAL , 3JAR , 3TQ7 , 7SJ9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00307 CH 14 120 Calponin homology (CH) domain Domain
PF03271 EB1 219 257 EB1-like C-terminal motif Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in brain and muscle. {ECO:0000269|PubMed:10644998}.
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD

GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAP
PCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVISGIIGILYA
TEEGFAPPEDDEIEEHQQEDQDEY
Sequence length 281
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Azoospermia Associate 38403804
Azoospermia Nonobstructive Associate 38403804
Biliary Atresia Associate 40665272
Ciliary Motility Disorders Associate 16055928
Prostatic Neoplasms Associate 28319065
Retinitis Pigmentosa Associate 16055928