Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22920
Gene name Gene Name - the full gene name approved by the HGNC.	Kinesin associated protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KIFAP3
Synonyms (NCBI Gene) Gene synonyms aliases	FLA3, KAP-1, KAP-3, KAP3, SMAP, Smg-GDS, dJ190I16.1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030958	hsa-miR-21-5p	Microarray	18591254
MIRT039305	hsa-miR-425-5p	CLASH	23622248
MIRT037774	hsa-miR-671-3p	CLASH	23622248
MIRT2256755	hsa-miR-576-3p	CLIP-seq
MIRT2558199	hsa-miR-4423-3p	CLIP-seq
MIRT2558200	hsa-miR-586	CLIP-seq
MIRT2683487	hsa-miR-1273d	CLIP-seq
MIRT2558199	hsa-miR-4423-3p	CLIP-seq
MIRT2558200	hsa-miR-586	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000794	Component	Condensed nuclear chromosome	IDA	16298999
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0005515	Function	Protein binding	IPI	9506951, 16298999, 21516116, 24338362, 25416956, 25910212, 26496610, 26871637, 27173435, 28514442, 31515488, 32296183, 33961781, 35271311
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	8900189
GO:0005794	Component	Golgi apparatus	IEA
GO:0005813	Component	Centrosome	IDA	16298999
GO:0005829	Component	Cytosol	TAS
GO:0005871	Component	Kinesin complex	IEA
GO:0005876	Component	Spindle microtubule	IDA	16298999
GO:0005929	Component	Cilium	TAS
GO:0005930	Component	Axoneme	IBA
GO:0005930	Component	Axoneme	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007017	Process	Microtubule-based process	ISS
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007165	Process	Signal transduction	TAS	8900189
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007406	Process	Negative regulation of neuroblast proliferation	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA	16298999
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016939	Component	Kinesin II complex	IBA
GO:0016939	Component	Kinesin II complex	IDA	16298999
GO:0016939	Component	Kinesin II complex	IEA
GO:0016939	Component	Kinesin II complex	ISS
GO:0019894	Function	Kinesin binding	IEA
GO:0019894	Function	Kinesin binding	IPI	16298999
GO:0019903	Function	Protein phosphatase binding	IPI	24338362
GO:0032391	Component	Photoreceptor connecting cilium	IEA
GO:0032839	Component	Dendrite cytoplasm	IEA
GO:0035869	Component	Ciliary transition zone	IBA
GO:0036064	Component	Ciliary basal body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0044782	Process	Cilium organization	IBA
GO:0046587	Process	Positive regulation of calcium-dependent cell-cell adhesion	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	8900189
GO:0070242	Process	Thymocyte apoptotic process	IEA
GO:0070244	Process	Negative regulation of thymocyte apoptotic process	IEA
GO:0072383	Process	Plus-end-directed vesicle transport along microtubule	TAS	16298999
GO:0097542	Component	Ciliary tip	TAS
GO:0098794	Component	Postsynapse	IEA
GO:0098971	Process	Anterograde dendritic transport of neurotransmitter receptor complex	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0120170	Function	Intraciliary transport particle B binding	IEA
GO:1990075	Component	Periciliary membrane compartment	IEA

MIM	HGNC	e!Ensembl
601836	17060	ENSG00000075945

Protein

UniProt ID

Q92845

Protein name

Kinesin-associated protein 3 (KAP-3) (KAP3) (Smg GDS-associated protein)

Protein function

Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex (By similar

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05804	KAP	13 → 720		Family

Sequence

MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKS
LNANTDITSLARKVVEECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPP
FEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALA
RVLREDWKQSVELATNIIYIFFCFSSFSQFHGLITHYKIGALCMNIIDHELKRHELWQEE
LSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMR
NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDL
LNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMF
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKFKD
PLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWEL
VLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNA
QQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDII
AEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDL
FYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGF
RPDEPYYYGYGS

Sequence length

792

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		MHC class II antigen presentation Intraflagellar transport COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Inhibit	19451621
Amyotrophic Lateral Sclerosis	Associate	20566859, 24838185
Carcinoma Basal Cell	Associate	34674729
Carcinoma Renal Cell	Associate	25230976
Carcinoma Signet Ring Cell	Inhibit	35322078
Endometriosis	Associate	25296917
Liver Neoplasms	Associate	19451621
Uveitis Anterior	Associate	32492107

KIFAP3 (kinesin associated protein 3)