Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22918
Gene name Gene Name - the full gene name approved by the HGNC.
CD93 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD93
Synonyms (NCBI Gene) Gene synonyms aliases
C1QR1, C1qR(P), C1qRP, CDw93, ECSM3, MXRA4, dJ737E23.1
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be i
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT438266 hsa-miR-29a-3p Luciferase reporter assay 24085298
MIRT438266 hsa-miR-29a-3p Luciferase reporter assay 24085298
MIRT608460 hsa-miR-6867-5p HITS-CLIP 24906430
MIRT608459 hsa-miR-6818-5p HITS-CLIP 24906430
MIRT608458 hsa-miR-574-5p HITS-CLIP 24906430
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001849 Function Complement component C1q complex binding IDA 11781389
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 15459234, 15819698
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
120577 15855 ENSG00000125810
Protein
UniProt ID Q9NPY3
Protein name Complement component C1q receptor (C1q/MBL/SPA receptor) (C1qR) (C1qR(p)) (C1qRp) (CDw93) (Complement component 1 q subcomponent receptor 1) (Matrix-remodeling-associated protein 4) (CD antigen CD93)
Protein function Cell surface receptor that plays a role in various physiological processes including inflammation, phagocytosis, and cell adhesion. Plays a role in phagocytosis and enhances the uptake of apoptotic cells and immune complexes by acting as a recep
PDB 8A59 , 8IVD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 42 181 Lectin C-type domain Domain
PF12662 cEGF 325 348 Complement Clr-like EGF-like Domain
PF12662 cEGF 406 430 Complement Clr-like EGF-like Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.
Sequence
MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNL
ATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGG
EDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVC
K
FSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLC
KEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
ASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVN
TPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE
DGTQCQDVDE
CVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGP
PDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGS
PGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALA
LGLLVYRKRRAKREEKKEKKPQNAADSYSWVPERAESRAMENQYSPTPGTDC
Sequence length 652
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Unknown
Disease term Disease name Evidence References Source
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Atypical Squamous Cells of the Cervix Associate 23268996, 23651874, 25288439
Breast Neoplasms Associate 30670769
Carcinoma Adenoid Cystic Associate 21551254
Carcinoma Hepatocellular Associate 37483608
Cardiovascular Diseases Associate 33173973
Colorectal Neoplasms Associate 26008729
Coronary Artery Disease Associate 21332844
Coronary Disease Associate 18599554
Glioma Associate 36006582
Heart Diseases Associate 33173973